Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Transmembrane protein 14B

Product Specifications

CAS Number

9000-83-3

Gene Name

Transmembrane protein 14B

Gene Aliases

Transmembrane protein 14B.

Gene ID

81853

Reactivity

Homo sapiens|Human

Target

Primate-specific protein involved in cortical expansion and folding in the developing neocortex. May drive neural progenitor proliferation through nuclear translocation of IQGAP1, which in turn promotes G1/S cell cycle transitions.

Type

Protein

Source

E.coli

Sequence

MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGSVPSLAAGLLFGSLAGLGAYQLYQDPRNVWGFLAATSVTFVGVMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRMLMTSD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TMEM14B

Protein Name

Transmembrane protein 14B

Gene Name URL

TMEM14B

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Grids - Formvar/Carbon Coated - Copper 300 mesh
24930-25 25 EA

Grids - Formvar/Carbon Coated - Copper 300 mesh

Sign In for Pricing
View Details
Rabbit Olfactory receptor 8K3 (OR8K3) ELISA Kit
MBS7237774-01 48 Well

Rabbit Olfactory receptor 8K3 (OR8K3) ELISA Kit

Sign In for Pricing
View Details
Rabbit Olfactory receptor 8K3 (OR8K3) ELISA Kit
MBS7237774-02 96 Well

Rabbit Olfactory receptor 8K3 (OR8K3) ELISA Kit

Sign In for Pricing
View Details
Rabbit Olfactory receptor 8K3 (OR8K3) ELISA Kit
MBS7237774-03 5x 96 Well

Rabbit Olfactory receptor 8K3 (OR8K3) ELISA Kit

Sign In for Pricing
View Details
Rabbit Olfactory receptor 8K3 (OR8K3) ELISA Kit
MBS7237774-04 10x 96 Well

Rabbit Olfactory receptor 8K3 (OR8K3) ELISA Kit

Sign In for Pricing
View Details
CD3 (T-Cell Marker) Mouse Monoclonal Antibody
MBS439308-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

CD3 (T-Cell Marker) Mouse Monoclonal Antibody

Sign In for Pricing
View Details