Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Thrombospondin-2

Product Specifications

CAS Number

9000-83-3

Gene Name

Thrombospondin 2

Gene Aliases

Thbs-; Thbs-2; thrombospondin-2; TS; TSP2.

Gene ID

21826

Reactivity

Mouse|Mus musculus

Target

Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Ligand for CD36 mediating antiangiogenic properties.

Type

Protein

Source

E.coli

Sequence

GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGPGDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFYEQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

28.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Thbs2

Protein Name

Thrombospondin-2

Gene Name URL

Thbs2

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB43 shRNA (h) Lentiviral Particles
sc-92965-V 200 µL

ZBTB43 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
IFI35 Recombinant Protein Antigen
NBP3-17724PEP 100 µL

IFI35 Recombinant Protein Antigen

Sign In for Pricing
View Details
Recombinant Acorus calamus ATP synthase subunit alpha, chloroplastic (atpA), partial
MBS1397530 Inquire

Recombinant Acorus calamus ATP synthase subunit alpha, chloroplastic (atpA), partial

Sign In for Pricing
View Details
XBP1 CytoSection
TS424396P5 25 Slides

XBP1 CytoSection

Sign In for Pricing
View Details
CD316, ID (Immunoglobulin superfamily member 8, CD81 partner 3, Glu-Trp-Ile EWI motif-containing protein 2, EWI-2, Keratinocytes-associated transmembrane protein 4, KCT-4, LIR-D1, IGSF8, CD81P3, EWI2, KCT4) (MaxLight 750) discontinued
036929-ML750 100 µL

CD316, ID (Immunoglobulin superfamily member 8, CD81 partner 3, Glu-Trp-Ile EWI motif-containing protein 2, EWI-2, Keratinocytes-associated transmembrane protein 4, KCT-4, LIR-D1, IGSF8, CD81P3, EWI2, KCT4) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Human Vascular Cell Adhesion Molecule 1 (VCAM1) ELISA Kit
RDR-VCAM1-Hu-48Tests 48 Tests

Human Vascular Cell Adhesion Molecule 1 (VCAM1) ELISA Kit

Sign In for Pricing
View Details