Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Transcription elongation factor B polypeptide 1

Product Specifications

CAS Number

9000-83-3

Gene Name

Elongin C

Gene Aliases

Elongin 15 kDa subunit; elongin-C; RNA polymerase II transcription factor SIII subunit C; SIII; SIII p15; TCEB1; transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) ; transcription elongation factor B polypeptide 1; transcription elongation factor B subunit 1.

Gene ID

6921

Reactivity

Homo sapiens|Human

Target

SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex) (PubMed:7821821) . In embryonic stem cells, the elongin BC complex is recruited by EPOP to Polycomb group (PcG) target genes in order generate genomic region that display both active and repressive chromatin properties, an important feature of pluripotent stem cells (By similarity) .

Type

Protein

Source

E.coli

Sequence

MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ELOC

Protein Name

Elongin-C

Gene Name URL

ELOC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-GPN1 Polyclonal Antibody
PAV7629 100 μL

Rabbit Anti-GPN1 Polyclonal Antibody

Sign In for Pricing
View Details
Olr694 Protein Vector (Rat) (pPB-N-His)
PV290839 500 ng

Olr694 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Anti-ERCC1 Antibody (R1L30)
RHC29301 100 μg

Anti-ERCC1 Antibody (R1L30)

Sign In for Pricing
View Details
pCMV-CNDP2-3×FLAG-Neo Plasmid
PVT56833 2 µg

pCMV-CNDP2-3×FLAG-Neo Plasmid

Sign In for Pricing
View Details
CNKSR1 Protein Lysate (Human) with C-Ha Tag
16461031 100 µg

CNKSR1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
REL Antibody
MBS7116170-01 0.05 mg

REL Antibody

Sign In for Pricing
View Details