Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Striated muscle preferentially expressed protein kinase

Product Specifications

CAS Number

9000-83-3

Gene Name

Striated muscle enriched protein kinase

Gene Aliases

Aortic preferentially expressed gene 1; aortic preferentially expressed protein 1; APEG1; APEG-1; BPEG; CNM5; MYLK6; nuclear protein, marker for differentiated aortic smooth muscle and down-regulated with vascular injury; SPEG complex locus; SPEGalpha; SPEGbeta; striated muscle preferentially expressed protein kinase.

Gene ID

10290

Reactivity

Homo sapiens|Human

Target

Isoform 3 may have a role in regulating the growth and differentiation of arterial smooth muscle cells.

Type

Protein

Source

E.coli

Sequence

MQKARGTRGEDAGTRAPPSPGVPPKRAKVGAGGGAPVAVAGAPVFLRPLKNAAVCAGSDVRLRVVVSGTPQPSLRWFRDGQLLPAPAPEPSCLWLRRCGAQDAGVYSCMAQNE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SPEG

Protein Name

Striated muscle preferentially expressed protein kinase

Gene Name URL

SPEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL
BNC740253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF405S conjugate, 0.1mg/mL
BNC040871-500 1x 500 µL

CD71 (66IG10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL
BNC740177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), Biotin conjugate, 0.1mg/mL
BNCB0994-100 1x 100 µL

TNF alpha (J2D10), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details