Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Sorting nexin-20

Product Specifications

CAS Number

9000-83-3

Gene Name

Sorting nexin 20

Gene Aliases

Selectin ligand-interactor cytoplasmic 1; SLIC1; sorting nexin-20.

Gene ID

124460

Reactivity

Homo sapiens|Human

Target

May play a role in cellular vesicle trafficking. Has been proposed to function as a sorting protein that targets SELPLG into endosomes, but has no effect on SELPLG internalization from the cell surface, or on SELPLG-mediated cell-cell adhesion.

Type

Protein

Source

E.coli

Sequence

MASPEHPGSPGCMGPITQCTARTQQEAPATGPDLPHPGPDGHLDTHSGLSSNSSMTTRELQQYWQNQKCRWKHVKLLFEIASARIEERKVSKFVVYQIIVIQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SNX20

Protein Name

Sorting nexin-20

Gene Name URL

SNX20

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Zinc Finger with KRAB and SCAN Domains 4 (ZKSCAN4) ELISA Kit
OM622721 96 Strip Well

Bovine Zinc Finger with KRAB and SCAN Domains 4 (ZKSCAN4) ELISA Kit

Sign In for Pricing
View Details
ELISA Kit For TGF-beta receptor type-1
E8813r 96 Tests

ELISA Kit For TGF-beta receptor type-1

Sign In for Pricing
View Details
Mouse Monoclonal VSTM1 Antibody (01) [DyLight 594]
NBP3-06135DL594 0.1 mL

Mouse Monoclonal VSTM1 Antibody (01) [DyLight 594]

Sign In for Pricing
View Details
Phospho-Shc  (Tyr239/240)  Antibody
ABF3740 100 µg

Phospho-Shc (Tyr239/240) Antibody

Sign In for Pricing
View Details
Epo Double Nickase Plasmid (h)
sc-400283-NIC 20 µg

Epo Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Mouse Lipase, Endothelial (LIPG) ELISA Kit
abx052720-01 96 Tests

Mouse Lipase, Endothelial (LIPG) ELISA Kit

Sign In for Pricing
View Details