Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Sperm mitochondrial-associated cysteine-rich protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Sperm mitochondria associated cysteine rich protein

Gene Aliases

HSMCSGEN1; MCS; MCSP; sperm mitochondrial-associated cysteine-rich protein; testicular tissue protein Li 119; testicular tissue protein Li 161.

Gene ID

4184

Reactivity

Homo sapiens|Human

Target

Involved in sperm motility. Its absence is associated with genetic background dependent male infertility. Infertility may be due to reduced sperm motility in the female reproductive tract and inability to penetrate the oocyte zona pellucida (By similarity) .

Type

Protein

Source

E.coli

Sequence

MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SMCP

Protein Name

Sperm mitochondrial-associated cysteine-rich protein

Gene Name URL

SMCP

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBX6 Antibody, FITC conjugated
CSB-PA023258LC01HU-01 50 µg

TBX6 Antibody, FITC conjugated

Sign In for Pricing
View Details
TBX6 Antibody, FITC conjugated
CSB-PA023258LC01HU-02 100 µg

TBX6 Antibody, FITC conjugated

Sign In for Pricing
View Details
RAB40B ORF Vector (Human) (pORF)
38343011 1.0 µg DNA

RAB40B ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Avian Influenza Virus H9Subtype (AIV-H9) ELISA Kit
SL0041BI-01 96 Tests

Avian Influenza Virus H9Subtype (AIV-H9) ELISA Kit

Sign In for Pricing
View Details
Avian Influenza Virus H9Subtype (AIV-H9) ELISA Kit
SL0041BI-02 48 Tests

Avian Influenza Virus H9Subtype (AIV-H9) ELISA Kit

Sign In for Pricing
View Details
Human MINDY4B Pre-designed siRNA Set B
SI009598B 1 Each

Human MINDY4B Pre-designed siRNA Set B

Sign In for Pricing
View Details