Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Sperm mitochondrial-associated cysteine-rich protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Sperm mitochondria associated cysteine rich protein

Gene Aliases

HSMCSGEN1; MCS; MCSP; sperm mitochondrial-associated cysteine-rich protein; testicular tissue protein Li 119; testicular tissue protein Li 161.

Gene ID

4184

Reactivity

Homo sapiens|Human

Target

Involved in sperm motility. Its absence is associated with genetic background dependent male infertility. Infertility may be due to reduced sperm motility in the female reproductive tract and inability to penetrate the oocyte zona pellucida (By similarity) .

Type

Protein

Source

E.coli

Sequence

MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SMCP

Protein Name

Sperm mitochondrial-associated cysteine-rich protein

Gene Name URL

SMCP

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV-USP17L30 (human) -EGFP-Neo
BZ59682 1 Vial

PCMV-USP17L30 (human) -EGFP-Neo

Sign In for Pricing
View Details
Med15 (Mediator of RNA Polymerase II Transcription Subunit 15, Mediator Complex Subunit 15, Positive Cofactor 2 glutamine/Q-rich-Associated Protein, PC2 glutamine/Q-rich-Associated Protein, mPcqap, Med15, Pcqap) (PE)
MBS6457184-01 0.2 mL

Med15 (Mediator of RNA Polymerase II Transcription Subunit 15, Mediator Complex Subunit 15, Positive Cofactor 2 glutamine/Q-rich-Associated Protein, PC2 glutamine/Q-rich-Associated Protein, mPcqap, Med15, Pcqap) (PE)

Sign In for Pricing
View Details
Med15 (Mediator of RNA Polymerase II Transcription Subunit 15, Mediator Complex Subunit 15, Positive Cofactor 2 glutamine/Q-rich-Associated Protein, PC2 glutamine/Q-rich-Associated Protein, mPcqap, Med15, Pcqap) (PE)
MBS6457184-02 5x 0.2 mL

Med15 (Mediator of RNA Polymerase II Transcription Subunit 15, Mediator Complex Subunit 15, Positive Cofactor 2 glutamine/Q-rich-Associated Protein, PC2 glutamine/Q-rich-Associated Protein, mPcqap, Med15, Pcqap) (PE)

Sign In for Pricing
View Details
Rat Cnot6 ELISA Kit
ELI-50678r 96 Tests

Rat Cnot6 ELISA Kit

Sign In for Pricing
View Details
Rat Mgat4a ELISA Kit
ELI-23033r 96 Tests

Rat Mgat4a ELISA Kit

Sign In for Pricing
View Details
Sox17 Blocking Peptide (C-term)
MBS9229845-01 0.5 mg

Sox17 Blocking Peptide (C-term)

Sign In for Pricing
View Details