Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Ropporin-1B

Product Specifications

CAS Number

9000-83-3

Gene Name

Rhophilin associated tail protein 1B

Gene Aliases

AKAP-binding sperm protein ropporin; rhophilin-associated protein 1B; ropporin, rhophilin associated protein 1B; ropporin-1B; testis tissue sperm-binding protein Li 83P.

Gene ID

152015

Reactivity

Homo sapiens|Human

Target

Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA-dependent signaling processes required for spermatozoa capacitation.

Type

Protein

Source

E.coli

Sequence

MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ROPN1B

Protein Name

Ropporin-1B

Gene Name URL

ROPN1B

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P2Y9 (LPAR4) (NM_005296) Human Over-expression Lysate
LY401630 100 µg

P2Y9 (LPAR4) (NM_005296) Human Over-expression Lysate

Sign In for Pricing
View Details
HSP90AA1 Protein Vector (Rat) (pPM-C-HA)
23979026 500 ng

HSP90AA1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Human ESAM Alexa Fluor 647 Antibody (Clone 408519)
FAB4204R-100UG 100 µg

Human ESAM Alexa Fluor 647 Antibody (Clone 408519)

Sign In for Pricing
View Details
Gcnt7 (NM_001039560) Mouse Tagged ORF Clone
MG215614 10 µg

Gcnt7 (NM_001039560) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Lipt2 ORF Vector (Rat) (pORF)
26885016 1.0 µg DNA

Lipt2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
EmL3 (NM_001300794) Human Tagged ORF Clone
RC239782 10 µg

EmL3 (NM_001300794) Human Tagged ORF Clone

Sign In for Pricing
View Details