Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Regenerating islet-derived protein 3-alpha

Product Specifications

CAS Number

9000-83-3

Gene Name

Regenerating family member 3 alpha

Gene Aliases

Hepatocarcinoma-intestine-pancreas; hepatointestinal pancreatic protein; HIP; HIP/PAP; human proislet peptide; INGAP; pancreatic beta cell growth factor; pancreatitis-associated protein 1; PAP; PAP homologous protein; PAP1; PAP-H; PBCGF; proliferation-inducing protein 34; proliferation-inducing protein 42; reg III-alpha; REG3; REG-3-alpha; regenerating islet-derived 3 alpha; regenerating islet-derived protein 3-alpha; regenerating islet-derived protein III-alpha; REG-III.

Gene ID

5068

Reactivity

Homo sapiens|Human

Target

Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway.

Type

Protein

Source

E.coli

Sequence

EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD

Purification

Affinity purified using AC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Reconstitution

-20°C or -80°C

Molecular Weight

43.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

REG3A

Protein Name

Regenerating islet-derived protein 3-alpha

Gene Name URL

REG3A

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gap Junction Alpha-5 Protein / CX40 (GJA5) Antibody (HRP)
abx335781-01 20 µg

Gap Junction Alpha-5 Protein / CX40 (GJA5) Antibody (HRP)

Sign In for Pricing
View Details
Gap Junction Alpha-5 Protein / CX40 (GJA5) Antibody (HRP)
abx335781-02 50 µg

Gap Junction Alpha-5 Protein / CX40 (GJA5) Antibody (HRP)

Sign In for Pricing
View Details
Gap Junction Alpha-5 Protein / CX40 (GJA5) Antibody (HRP)
abx335781-03 100 µg

Gap Junction Alpha-5 Protein / CX40 (GJA5) Antibody (HRP)

Sign In for Pricing
View Details
Gap Junction Alpha-5 Protein / CX40 (GJA5) Antibody (HRP)
abx335781-04 200 µg

Gap Junction Alpha-5 Protein / CX40 (GJA5) Antibody (HRP)

Sign In for Pricing
View Details
Gap Junction Alpha-5 Protein / CX40 (GJA5) Antibody (HRP)
abx335781-05 1 mg

Gap Junction Alpha-5 Protein / CX40 (GJA5) Antibody (HRP)

Sign In for Pricing
View Details
MAP3K9 3'UTR Lenti-reporter-Luc Vector
28038081 1.0 µg

MAP3K9 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details