What is the catalog number for Recombinant human Poly [ADP-ribose] polymerase 11?

The catalog number for Recombinant human Poly [ADP-ribose] polymerase 11 is OPCA00177-20UG.

What sizes are available for Recombinant human Poly [ADP-ribose] polymerase 11?

Recombinant human Poly [ADP-ribose] polymerase 11 is available in the following size(s): 20 µg.

Is Recombinant human Poly [ADP-ribose] polymerase 11 in stock?

Recombinant human Poly [ADP-ribose] polymerase 11 is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant human Poly [ADP-ribose] polymerase 11

Product Specifications

CAS Number

9000-83-3

Gene Name

Poly (ADP-ribose) polymerase family member 11

Gene Aliases

ADP-ribosyltransferase diphtheria toxin-like 11; ARTD11; C12orf6; MIB006; poly [ADP-ribose] polymerase 11; protein mono-ADP-ribosyltransferase PARP11.

Gene ID

57097

Reactivity

Homo sapiens|Human

Target

Plays a role in nuclear envelope stability and nuclear remodeling during spermiogenesis (By similarity) . In vitro, exhibits mono (ADP-ribosyl) transferase activity (PubMed:25673562) .

Type

Protein

Source

E.coli

Sequence

FHKAEELFSKTTNNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSSEDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGAVFGKGTYFARDAAYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKDGSYVNLYDSCVDDTWNPKIFVVFDANQIYPEYLIDFH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.