Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Nephrocystin-1

Product Specifications

CAS Number

9000-83-3

Gene Name

Nephrocystin 1

Gene Aliases

JBTS4; juvenile nephronophthisis 1 protein; nephrocystin-1; nephronophthisis 1 (juvenile) ; NPH1; SLSN1.

Gene ID

4867

Reactivity

Homo sapiens|Human

Target

Together with BCAR1 it may play a role in the control of epithelial cell polarity. Involved in the organization of apical junctions in kidney cells together with NPHP4 and RPGRIP1L/NPHP8 (By similarity) . Does not seem to be strictly required for ciliogenesis (By similarity) . Seems to help to recruit PTK2B/PYK2 to cell matrix adhesions, thereby initiating phosphorylation of PTK2B/PYK2 and PTK2B/PYK2-dependent signaling. May play a role in the regulation of intraflagellar transport (IFT) during cilia assembly. Required for normal retina development. In connecting photoreceptor cilia influences the movement of some IFT proteins such as IFT88 and WDR19. Involved in spermatogenesis (By similarity) .

Type

Protein

Source

E.coli

Sequence

MLARRQRDPLQALRRRNQELKQQVDSLLSESQLKEALEPNKRQHIYQRCIQLKQAIDENKNALQKLSKADESAPVANYNQRKEEEHTLLDKLTQQLQGLAVTISRENIT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

NPHP1

Protein Name

Nephrocystin-1

Gene Name URL

NPHP1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGIF (TGIF1) Mouse Monoclonal Antibody [Clone ID: LBI4D10]
AMM15418VCF 100 µg

TGIF (TGIF1) Mouse Monoclonal Antibody [Clone ID: LBI4D10]

Sign In for Pricing
View Details
TP53 Antibody
orb675794-01 50 µg

TP53 Antibody

Sign In for Pricing
View Details
TP53 Antibody
orb675794-02 100 µg

TP53 Antibody

Sign In for Pricing
View Details
CDKN2B/p15 INK4b Rabbit Polyclonal Antibody (BF488)
orb2419685 100 µL

CDKN2B/p15 INK4b Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Gag-pro-pol Antibody
orb843498 2 mg

Gag-pro-pol Antibody

Sign In for Pricing
View Details
Gm428 Protein Vector (Mouse) (pPB-C-His)
PV183974 500 ng

Gm428 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details