Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Nicotinate phosphoribosyltransferase

Product Specifications

CAS Number

9000-83-3

Gene Name

Nicotinate phosphoribosyltransferase

Gene Aliases

FHA-HIT-interacting protein; NAPRT1; NAPRTase; nicotinate phosphoribosyltransferase; nicotinate phosphoribosyltransferase domain containing 1; nicotinate phosphoribosyltransferase domain-containing protein 1; nicotinic acid phosphoribosyltransferase; PP3856.

Gene ID

93100

Reactivity

Homo sapiens|Human

Target

Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN) . Essential for NA to increase cellular NAD levels and prevent oxidative stress of the cells.

Type

Protein

Source

E.coli

Sequence

MLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQGQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVVLSERLQALVNSLCAGQSP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

60.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

NAPRT

Protein Name

Nicotinate phosphoribosyltransferase

Gene Name URL

NAPRT

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r53 (NM_001104644) Mouse Tagged ORF Clone Lentiviral Particle
MR213144L4V 200 µL

Vmn2r53 (NM_001104644) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Pro-Matrix Metalloproteinase-9 Human Recombinant (ProMMP 9 Human)
PT_41870-01 2 µg

Pro-Matrix Metalloproteinase-9 Human Recombinant (ProMMP 9 Human)

Sign In for Pricing
View Details
Pro-Matrix Metalloproteinase-9 Human Recombinant (ProMMP 9 Human)
PT_41870-02 10 µg

Pro-Matrix Metalloproteinase-9 Human Recombinant (ProMMP 9 Human)

Sign In for Pricing
View Details
Pro-Matrix Metalloproteinase-9 Human Recombinant (ProMMP 9 Human)
PT_41870-03 1 mg

Pro-Matrix Metalloproteinase-9 Human Recombinant (ProMMP 9 Human)

Sign In for Pricing
View Details
Human SPP1 Pre-designed siRNA Set B
SI015703B 1 Each

Human SPP1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Cyclin B1 (G2/Mitotic-specific Cyclin-B1, CCNB1, CCNB) (MaxLight 750)
MBS6232387-01 0.1 mL

Cyclin B1 (G2/Mitotic-specific Cyclin-B1, CCNB1, CCNB) (MaxLight 750)

Sign In for Pricing
View Details