Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human PCNA-associated factor

Product Specifications

CAS Number

9000-83-3

Gene Name

PCNA clamp associated factor

Gene Aliases

HCV NS5A-transactivated protein 9; hepatitis C virus NS5A-transactivated protein 9; KIAA0101; L5; NS5ATP9; OEATC; OEATC1; OEATC-1; overexpressed in anaplastic thyroid carcinoma 1; p15 (PAF) ; p15/PAF; p15PAF; PAF; PAF15; PCNA-associated factor; PCNA-associated factor of 15 kDa; PCNA-clamp-associated factor.

Gene ID

9768

Reactivity

Homo sapiens|Human

Target

PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes, facilitating the bypass of replication-fork-blocking lesions. Also acts as a regulator of centrosome number.

Type

Protein

Source

E.coli

Sequence

MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PCLAF

Protein Name

PCNA-associated factor

Gene Name URL

PCLAF

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Afamin (AFM) ELISA Kit
QY-E04447 96 Tests

Human Afamin (AFM) ELISA Kit

Sign In for Pricing
View Details
Monkey Phospho-Polo-Like Kinase 1 (PPLK1) ELISA Kit
MBS9902966-01 48 Well

Monkey Phospho-Polo-Like Kinase 1 (PPLK1) ELISA Kit

Sign In for Pricing
View Details
Monkey Phospho-Polo-Like Kinase 1 (PPLK1) ELISA Kit
MBS9902966-02 96 Well

Monkey Phospho-Polo-Like Kinase 1 (PPLK1) ELISA Kit

Sign In for Pricing
View Details
Monkey Phospho-Polo-Like Kinase 1 (PPLK1) ELISA Kit
MBS9902966-03 5x 96 Well

Monkey Phospho-Polo-Like Kinase 1 (PPLK1) ELISA Kit

Sign In for Pricing
View Details
Monkey Phospho-Polo-Like Kinase 1 (PPLK1) ELISA Kit
MBS9902966-04 10x 96 Well

Monkey Phospho-Polo-Like Kinase 1 (PPLK1) ELISA Kit

Sign In for Pricing
View Details
SERPINE1 ELISA Kit (Pig) (OKEH07417)
OKEH07417 96 Well

SERPINE1 ELISA Kit (Pig) (OKEH07417)

Sign In for Pricing
View Details