Recombinant human Junctional adhesion molecule B
Product Specifications
CAS Number
9000-83-3
Gene Name
Junctional adhesion molecule 2
Gene Aliases
C21orf43; CD322; IBGC8; JAM-2; JAMB; JAM-B; JAM-IT/VE-JAM; Junctional adhesion molecule 2; junctional adhesion molecule B; PRO245; vascular endothelial junction-associated molecule; VEJAM; VE-JAM.
Gene ID
58494
Reactivity
Homo sapiens|Human
Target
May play a role in the processes of lymphocyte homing to secondary lymphoid organs.
Type
Protein
Source
E.coli
Sequence
FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions
Reconstitution & Storage Instructions
Western Blotting/Immunoblotting (WB/IB) Protocol
Western Blotting/Immunoblotting (WB/IB) Protocol
Immunohistochemistry (IHC) Protocol
Immunohistochemistry (IHC) Protocol
Immunocytochemistry (ICC) Protocol
Immunocytochemistry (ICC) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Blocking Peptide Competition Protocol (BPCP)
Blocking Peptide Competition Protocol (BPCP)
Immunoprecipitation (IP) Protocol
Immunoprecipitation (IP) Protocol
Antibody Array (AA) Protocol
Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
27.5 kDa
Protein Length
Recombinant
NCBI Gene Symbol
JAM2
Protein Name
Junctional adhesion molecule B
Gene Name URL
JAM2
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1466185-01 0.02 mg (E-Coli)
Recombinant Mycoplasma mycoides subsp. mycoides SC Probable rRNA maturation factor (MSC_0461)
Sign In for Pricing
View Details 
MBS1466185-02 0.1 mg (E-Coli)
Recombinant Mycoplasma mycoides subsp. mycoides SC Probable rRNA maturation factor (MSC_0461)
Sign In for Pricing
View Details 
MBS1466185-03 0.02 mg (Yeast)
Recombinant Mycoplasma mycoides subsp. mycoides SC Probable rRNA maturation factor (MSC_0461)
Sign In for Pricing
View Details MBS1466185-04 0.1 mg (Yeast)
Recombinant Mycoplasma mycoides subsp. mycoides SC Probable rRNA maturation factor (MSC_0461)
Sign In for Pricing
View Details MBS1466185-05 0.02 mg (Baculovirus)
Recombinant Mycoplasma mycoides subsp. mycoides SC Probable rRNA maturation factor (MSC_0461)
Sign In for Pricing
View Details MBS1466185-06 0.02 mg (Mammalian-Cell)
Recombinant Mycoplasma mycoides subsp. mycoides SC Probable rRNA maturation factor (MSC_0461)
Sign In for Pricing
View Details