Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant sheep Interleukin-6

Product Specifications

CAS Number

9000-83-3

Gene Name

Interleukin 6

Gene Aliases

IL-6; interleukin 6 (interferon, beta 2) ; interleukin-6.

Gene ID

443406

Reactivity

Ovis aries|Sheep

Target

Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T (H) 17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation (By similarity) .

Type

Protein

Source

E.coli

Sequence

GPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

47.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

IL6

Protein Name

Interleukin-6

Gene Name URL

IL6

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL
BNC470270-500 1x 500 µL

Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL
BNC940437-100 1x 100 µL

CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL
BNC940034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
BNC680034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details