Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant sheep Interleukin-6

Product Specifications

CAS Number

9000-83-3

Gene Name

Interleukin 6

Gene Aliases

IL-6; interleukin 6 (interferon, beta 2) ; interleukin-6.

Gene ID

443406

Reactivity

Ovis aries|Sheep

Target

Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T (H) 17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation (By similarity) .

Type

Protein

Source

E.coli

Sequence

GPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

47.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

IL6

Protein Name

Interleukin-6

Gene Name URL

IL6

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB3GAP1 Rabbit Polyclonal Antibody
TA362084 100 µL

RAB3GAP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CASP8AP2 Protein Vector (Rat) (pPB-N-His)
PV257631 500 ng

CASP8AP2 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
MMADHC Antibody Blocking peptide
orb1453149 500 µg

MMADHC Antibody Blocking peptide

Sign In for Pricing
View Details
Adjustable Wrench, Scissors Shaped
2032120/4 1 Each

Adjustable Wrench, Scissors Shaped

Sign In for Pricing
View Details
MARK3 (NM_001128919) Human Tagged Lenti ORF Clone
RC226129L3 10 µg

MARK3 (NM_001128919) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
hsa-miR-4282 miRNA Inhibitor
MIH02228 2x 5.0 nmol

hsa-miR-4282 miRNA Inhibitor

Sign In for Pricing
View Details