Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sus scrofa (Pig) Interleukin-33

Product Specifications

CAS Number

9000-83-3

Gene Name

Interleukin 33

Gene Aliases

IL-33; interleukin-33.

Gene ID

100518643

Reactivity

Porcine|Sus scrofa

Target

Recombinant Sus scrofa (Pig) Interleukin-33

Type

Protein

Source

E.coli

Sequence

EHSASLSTYNDQYITFAFEDGSYEIYVEDLRKDQEKDKVLLRYYDSQIPSSETDGGGDHRKLMVNLSPTKDKDFLLHANSKEHSVELQKCENPLPEQAFFVLHEQPSKCVSFECKSHPGVFLGVKNNQLALIKLGEHPEDSNRENTTFKLSNLM

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

44.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

IL33

Protein Name

Interleukin-33

Gene Name URL

IL33

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTK9L, NT (TWF2, PTK9L, Twinfilin-2, A6-related protein, Protein tyrosine kinase 9-like, Twinfilin-1-like protein) (MaxLight 405)
MBS6338837-01 0.1 mL

PTK9L, NT (TWF2, PTK9L, Twinfilin-2, A6-related protein, Protein tyrosine kinase 9-like, Twinfilin-1-like protein) (MaxLight 405)

Sign In for Pricing
View Details
PTK9L, NT (TWF2, PTK9L, Twinfilin-2, A6-related protein, Protein tyrosine kinase 9-like, Twinfilin-1-like protein) (MaxLight 405)
MBS6338837-02 5x 0.1 mL

PTK9L, NT (TWF2, PTK9L, Twinfilin-2, A6-related protein, Protein tyrosine kinase 9-like, Twinfilin-1-like protein) (MaxLight 405)

Sign In for Pricing
View Details
Human Small G protein signaling modulator 1, SGSM1 ELISA Kit
MBS9336672-01 48 Well

Human Small G protein signaling modulator 1, SGSM1 ELISA Kit

Sign In for Pricing
View Details
Human Small G protein signaling modulator 1, SGSM1 ELISA Kit
MBS9336672-02 96 Well

Human Small G protein signaling modulator 1, SGSM1 ELISA Kit

Sign In for Pricing
View Details
Human Small G protein signaling modulator 1, SGSM1 ELISA Kit
MBS9336672-03 5x 96 Well

Human Small G protein signaling modulator 1, SGSM1 ELISA Kit

Sign In for Pricing
View Details
Human Small G protein signaling modulator 1, SGSM1 ELISA Kit
MBS9336672-04 10x 96 Well

Human Small G protein signaling modulator 1, SGSM1 ELISA Kit

Sign In for Pricing
View Details