Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L2RB Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Interleukin 2 receptor, beta chain

Gene Aliases

CD122; high affinity IL-2 receptor subunit beta; IL-15 receptor beta chain; IL15R; IL-15R; IL15Rbeta; IL-15Rbeta; IL-2 receptor beta chain; IL-2 receptor subunit beta; IL-2/15 receptor-beta; Il-2/15Rbeta; Il-2R; IL-2R subunit beta; IL-2RB; Il-2Rbeta; interleukin-2 receptor subunit beta; p70; p70-75.

Gene ID

16185

Reactivity

Mouse|Mus musculus

Target

Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.

Type

Protein

Source

E.coli

Sequence

ASAAVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.1-5 mg/ml (Bradford method)

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

29.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Il2rb

Protein Name

Interleukin-2 receptor subunit beta

Gene Name URL

Il2rb

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFE3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2362405 3x 1.0 µg

TFE3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Canine Endomorphin 1 ELISA Kit
GTR10362555 96 Well

Canine Endomorphin 1 ELISA Kit

Sign In for Pricing
View Details
Rabbit Yorkie homolog (YAP1) ELISA Kit
MBS7207771-01 48 Well

Rabbit Yorkie homolog (YAP1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Yorkie homolog (YAP1) ELISA Kit
MBS7207771-02 96 Well

Rabbit Yorkie homolog (YAP1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Yorkie homolog (YAP1) ELISA Kit
MBS7207771-03 5x 96 Well

Rabbit Yorkie homolog (YAP1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Yorkie homolog (YAP1) ELISA Kit
MBS7207771-04 10x 96 Well

Rabbit Yorkie homolog (YAP1) ELISA Kit

Sign In for Pricing
View Details