Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant sheep Interleukin-12 subunit beta

Product Specifications

CAS Number

9000-83-3

Gene Name

Interleukin 12B

Gene Aliases

CLMF p40; cytotoxic lymphocyte maturation factor 40 kDa subunit; IL-12; IL-12 subunit p40; IL-12B; interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) ; interleukin-12 p40 subunit; interleukin-12 subunit beta.

Gene ID

443472

Reactivity

Ovis aries|Sheep

Target

Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.

Type

Protein

Source

E.coli

Sequence

IWELEKNVYVVELDWYPNAPGETVVLTCDTPEEDGITWTSDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSRSLLLLHKKEDGIWSTDILKDQKEPKAKSFLKCEAKDYSGHFTCSWLTAISTNLKFSVKSSRGSSDPRGVTCGAASLSAEKVSMDHREYNKYTVECQEGSACPAAEESLPIEVVMEAVHKLKYENYTSSFFIRDIIKPDPPKNLQLRPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKNKREKKLFTDQTSAKVTCHKDANIRVQARDRYYSSFWSEWASVSCS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

IL12B

Protein Name

Interleukin-12 subunit beta

Gene Name URL

IL12B

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HTR1F antibody
MBS535511-01 0.05 mg

HTR1F antibody

Sign In for Pricing
View Details
HTR1F antibody
MBS535511-02 5x 0.05 mg

HTR1F antibody

Sign In for Pricing
View Details
OKCD02939-96W - TOP1 ELISA Kit (Rat)
OKCD02939-96W 96 Well

OKCD02939-96W - TOP1 ELISA Kit (Rat)

Sign In for Pricing
View Details
ZMYM4 Lentiviral Activation Particles (m2)
sc-426741-LAC-2 200 µL

ZMYM4 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Phospho-PTPRA (Tyr798) Polyclonal Antibody, Cy7 Conjugated
bs-5179R-Cy7 100 µL

Phospho-PTPRA (Tyr798) Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
NNC 05-2090 (hydrochloride)
HY-103509-01 5 mg

NNC 05-2090 (hydrochloride)

Sign In for Pricing
View Details