Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Islet cell autoantigen 1

Product Specifications

CAS Number

9000-83-3

Gene Name

Islet cell autoantigen 1

Gene Aliases

69 kDa islet cell autoantigen; diabetes mellitus type I autoantigen; ICA69; ICAp69; islet cell autoantigen 1; islet cell autoantigen 1, 69kDa; islet cell autoantigen p69; p69; testicular tissue protein Li 162.

Gene ID

3382

Reactivity

Homo sapiens|Human

Target

May play a role in neurotransmitter secretion.

Type

Protein

Source

E.coli

Sequence

MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

35.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ICA1

Protein Name

Islet cell autoantigen 1

Gene Name URL

ICA1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Favipiravir Impurity 26
RM-F012226-01 10 mg

Favipiravir Impurity 26

Sign In for Pricing
View Details
Favipiravir Impurity 26
RM-F012226-02 25 mg

Favipiravir Impurity 26

Sign In for Pricing
View Details
Favipiravir Impurity 26
RM-F012226-03 50 mg

Favipiravir Impurity 26

Sign In for Pricing
View Details
Favipiravir Impurity 26
RM-F012226-04 100 mg

Favipiravir Impurity 26

Sign In for Pricing
View Details
Beta-Nerve Growth factor
307894-01 50 µg

Beta-Nerve Growth factor

Sign In for Pricing
View Details
Beta-Nerve Growth factor
307894-02 100 µg

Beta-Nerve Growth factor

Sign In for Pricing
View Details