Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Histone H2B type 1-M

Product Specifications

CAS Number

9000-83-3

Gene Name

H2B clustered histone 14

Gene Aliases

H2B 291B; H2b-291b; Hist1h2; Hist1h2bm; histone 1, H2bm; histone cluster 1, H2bm; histone H2B type 1-M.

Gene ID

319186

Reactivity

Mouse|Mus musculus

Target

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Type

Protein

Source

E.coli

Sequence

PEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

17.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

H2bc14

Protein Name

Histone H2B type 1-M

Gene Name URL

H2bc14

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKC alpha (PRKCA) Rabbit Polyclonal Antibody
TA327797 100 µL

PKC alpha (PRKCA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZSCAN21 Polyclonal Antibody
A70839-100 100 µL

ZSCAN21 Polyclonal Antibody

Sign In for Pricing
View Details
RNF41 (NM_005785) Human Tagged Lenti ORF Clone
RC217918L4 10 µg

RNF41 (NM_005785) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Cochliodinol
sc-202108 500 µg

Cochliodinol

Sign In for Pricing
View Details
Rabbit anti-Synechococcus elongatus (strain PCC 7942)(Anacystis nidulans R2) ISPH Polyclonal Antibody
MBS7193612 Inquire

Rabbit anti-Synechococcus elongatus (strain PCC 7942)(Anacystis nidulans R2) ISPH Polyclonal Antibody

Sign In for Pricing
View Details
Canine TTR (Transthyretin) ValidElisa Kit
EK343973 96 Well

Canine TTR (Transthyretin) ValidElisa Kit

Sign In for Pricing
View Details