Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Histone H2B type 1-M

Product Specifications

CAS Number

9000-83-3

Gene Name

H2B clustered histone 14

Gene Aliases

H2B 291B; H2b-291b; Hist1h2; Hist1h2bm; histone 1, H2bm; histone cluster 1, H2bm; histone H2B type 1-M.

Gene ID

319186

Reactivity

Mouse|Mus musculus

Target

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Type

Protein

Source

E.coli

Sequence

PEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

17.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

H2bc14

Protein Name

Histone H2B type 1-M

Gene Name URL

H2bc14

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RTL10 (NM_024627) Human Over-expression Lysate
LS079680-20ug 20 µg

RTL10 (NM_024627) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal CCDC5 Antibody [DyLight 650]
NBP3-06419C 0.1 mL

Rabbit Polyclonal CCDC5 Antibody [DyLight 650]

Sign In for Pricing
View Details
COL18A1 Protein Vector (Rat) (pPM-C-HA)
16559026 500 ng

COL18A1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Compound NP-023184
T128436-01 10 mg

Compound NP-023184

Sign In for Pricing
View Details
Compound NP-023184
T128436-02 1 g

Compound NP-023184

Sign In for Pricing
View Details
Compound NP-023184
T128436-03 1 mg

Compound NP-023184

Sign In for Pricing
View Details