Recombinant human Histone H2A type 1
Product Specifications
CAS Number
9000-83-3
Gene Name
H2A clustered histone 11|H2A clustered histone 13|H2A clustered histone 15|H2A clustered histone 16|H2A clustered histone 17
Gene Aliases
DJ193B12.1; dJ193B12.9; H2A histone family, member C; H2A histone family, member D; H2A histone family, member I; H2A histone family, member N; H2A histone family, member P; H2A.1; H2A.1b; H2A.i; H2A/c; H2A/d; H2A/i; H2A/n; H2A/p; H2AC11; H2AC13; H2AC14; H2AC15; H2AC16; H2AC17; H2AFC; H2AFD; H2AFI; H2AFN; H2AFP; H2AG; HIST1H2AG; HIST1H2AI; HIST1H2AK; HIST1H2AL; HIST1H2AM; histone 1, H2ag; histone 1, H2ai; histone 1, H2ak; histone 1, H2al; histone 1, H2am; histone cluster 1 H2A family member g; histone cluster 1 H2A family member i; histone cluster 1 H2A family member k; histone cluster 1 H2A family member l; histone cluster 1 H2A family member m; histone cluster 1, H2ag; histone cluster 1, H2ai; histone cluster 1, H2ak; histone cluster 1, H2al; histone cluster 1, H2am; histone H2A type 1; histone H2A type 1-J; histone H2A/p; histone H2A/ptl; pH2A/f.
Gene ID
8329|8330|8332|8336|8969
Reactivity
Homo sapiens|Human
Target
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Type
Protein
Source
E.coli
Sequence
SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions
Reconstitution & Storage Instructions
Western Blotting/Immunoblotting (WB/IB) Protocol
Western Blotting/Immunoblotting (WB/IB) Protocol
Immunohistochemistry (IHC) Protocol
Immunohistochemistry (IHC) Protocol
Immunocytochemistry (ICC) Protocol
Immunocytochemistry (ICC) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Blocking Peptide Competition Protocol (BPCP)
Blocking Peptide Competition Protocol (BPCP)
Immunoprecipitation (IP) Protocol
Immunoprecipitation (IP) Protocol
Antibody Array (AA) Protocol
Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
18 kDa
Protein Length
Recombinant
NCBI Gene Symbol
H2AC11|H2AC13|H2AC15|H2AC16|H2AC17
Protein Name
Histone H2A type 1
Gene Name URL
H2AC11|H2AC13|H2AC15|H2AC16|H2AC17
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog