Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Histone H2A type 1

Product Specifications

CAS Number

9000-83-3

Gene Name

H2A clustered histone 11|H2A clustered histone 13|H2A clustered histone 15|H2A clustered histone 16|H2A clustered histone 17

Gene Aliases

DJ193B12.1; dJ193B12.9; H2A histone family, member C; H2A histone family, member D; H2A histone family, member I; H2A histone family, member N; H2A histone family, member P; H2A.1; H2A.1b; H2A.i; H2A/c; H2A/d; H2A/i; H2A/n; H2A/p; H2AC11; H2AC13; H2AC14; H2AC15; H2AC16; H2AC17; H2AFC; H2AFD; H2AFI; H2AFN; H2AFP; H2AG; HIST1H2AG; HIST1H2AI; HIST1H2AK; HIST1H2AL; HIST1H2AM; histone 1, H2ag; histone 1, H2ai; histone 1, H2ak; histone 1, H2al; histone 1, H2am; histone cluster 1 H2A family member g; histone cluster 1 H2A family member i; histone cluster 1 H2A family member k; histone cluster 1 H2A family member l; histone cluster 1 H2A family member m; histone cluster 1, H2ag; histone cluster 1, H2ai; histone cluster 1, H2ak; histone cluster 1, H2al; histone cluster 1, H2am; histone H2A type 1; histone H2A type 1-J; histone H2A/p; histone H2A/ptl; pH2A/f.

Gene ID

8329|8330|8332|8336|8969

Reactivity

Homo sapiens|Human

Target

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Type

Protein

Source

E.coli

Sequence

SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

18 kDa

Protein Length

Recombinant

NCBI Gene Symbol

H2AC11|H2AC13|H2AC15|H2AC16|H2AC17

Protein Name

Histone H2A type 1

Gene Name URL

H2AC11|H2AC13|H2AC15|H2AC16|H2AC17

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASSF7 (NM_001143994) Human Tagged ORF Clone
RG227998 10 µg

RASSF7 (NM_001143994) Human Tagged ORF Clone

Sign In for Pricing
View Details
SR-6 Rabbit Polyclonal Antibody
E28PT4408 100 µL

SR-6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Z-Lys (Z) -OSu 10g
A23841-10000 10000 mg

Z-Lys (Z) -OSu 10g

Sign In for Pricing
View Details
Monkey Plakophilin 1 (PKP1) ELISA Kit
abx359412 96 Well

Monkey Plakophilin 1 (PKP1) ELISA Kit

Sign In for Pricing
View Details
pCMV-FLAG-KDM6A Plasmid
PVT45387 2 µg

pCMV-FLAG-KDM6A Plasmid

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype O:3 Glycine--tRNA ligase alpha subunit (glyQ)
MBS1112767-01 0.02 mg (E-Coli)

Recombinant Yersinia pseudotuberculosis serotype O:3 Glycine--tRNA ligase alpha subunit (glyQ)

Sign In for Pricing
View Details