Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Hemoglobin subunit alpha

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Alpha-globin; Hemoglobin alpha chain.

Reactivity

Mouse|Mus musculus

Target

Involved in oxygen transport from the lung to the various peripheral tissues.

Type

Protein

Source

E.coli

Sequence

VLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGKKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSKYR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

19 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HBA

Protein Name

Hemoglobin subunit alpha

Gene Name URL

HBA

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIPC3, CT (GIPC3, C19orf64, PDZ domain-containing protein GIPC3) (MaxLight 405) discontinued
036046-ML405 100 µL

GIPC3, CT (GIPC3, C19orf64, PDZ domain-containing protein GIPC3) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Sheep Ras-Related Protein Rab-18 (RAB18) ELISA Kit
MBS9918631-01 48 Well

Sheep Ras-Related Protein Rab-18 (RAB18) ELISA Kit

Sign In for Pricing
View Details
Sheep Ras-Related Protein Rab-18 (RAB18) ELISA Kit
MBS9918631-02 96 Well

Sheep Ras-Related Protein Rab-18 (RAB18) ELISA Kit

Sign In for Pricing
View Details
Sheep Ras-Related Protein Rab-18 (RAB18) ELISA Kit
MBS9918631-03 5x 96 Well

Sheep Ras-Related Protein Rab-18 (RAB18) ELISA Kit

Sign In for Pricing
View Details
Sheep Ras-Related Protein Rab-18 (RAB18) ELISA Kit
MBS9918631-04 10x 96 Well

Sheep Ras-Related Protein Rab-18 (RAB18) ELISA Kit

Sign In for Pricing
View Details
Recombinant Bovine Plasminogen Activator Inhibitor 1 (SERPINE1), N-His
AP9F23-01 1 mg

Recombinant Bovine Plasminogen Activator Inhibitor 1 (SERPINE1), N-His

Sign In for Pricing
View Details