Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human General transcription factor IIH subunit 5

Product Specifications

CAS Number

9000-83-3

Gene Name

General transcription factor IIH subunit 5

Gene Aliases

BA120J8.2; C6orf175; General transcription factor IIH polypeptide 5; general transcription factor IIH subunit 5; general transcription factor IIH, polypeptide 5; TFB5; TFB5 ortholog; TFIIH; TFIIH basal transcription factor complex TTDA subunit; TFIIH basal transcription factor complex TTD-A subunit; TFIIH subunit p8; TGF2H5; TTD; TTD3; TTDA; TTD-A.

Gene ID

404672

Reactivity

Homo sapiens|Human

Target

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription. Necessary for the stability of the TFIIH complex and for the presence of normal levels of TFIIH in the cell.

Type

Protein

Source

E.coli

Sequence

MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

35.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GTF2H5

Protein Name

General transcription factor IIH subunit 5

Gene Name URL

GTF2H5

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Connexin 43 (CX43)
RPU40996-01 50 µg

Recombinant Mouse Connexin 43 (CX43)

Sign In for Pricing
View Details
Recombinant Mouse Connexin 43 (CX43)
RPU40996-02 100 µg

Recombinant Mouse Connexin 43 (CX43)

Sign In for Pricing
View Details
Recombinant Mouse Connexin 43 (CX43)
RPU40996-03 1 mg

Recombinant Mouse Connexin 43 (CX43)

Sign In for Pricing
View Details
CD38 Mouse mAb
MBS4753762-01 0.1 mL

CD38 Mouse mAb

Sign In for Pricing
View Details
CD38 Mouse mAb
MBS4753762-02 5x 0.1 mL

CD38 Mouse mAb

Sign In for Pricing
View Details
Anti-RPS5 Antibody Picoband® (Biotine Conjugate)
A04460-2-Biotin 100 µg/Vial

Anti-RPS5 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details