Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Glucagon receptor

Product Specifications

CAS Number

9000-83-3

Gene Name

Glucagon receptor

Gene Aliases

G; GL-R; glucagon receptor; GR.

Gene ID

14527

Reactivity

Mouse|Mus musculus

Target

G-protein coupled receptor for glucagon that plays a central role in the regulation of blood glucose levels and glucose homeostasis. Regulates the rate of hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis. Plays an important role in mediating the responses to fasting. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Promotes activation of adenylate cyclase. Besides, plays a role in signaling via a phosphatidylinositol-calcium second messenger system.

Type

Protein

Source

E.coli

Sequence

AQVMDFLFEKWKLYSDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPPNTTANISCPWYLPWYHKVQHRLVFKRCGPDGQWVRGPRGQPWRNASQCQLDDEEIEVQKGVAKMYSSQQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Gcgr

Protein Name

Glucagon receptor

Gene Name URL

Gcgr

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ku70/XRCC6 Colorimetric Cell-Based ELISA Kit (OKAG00839)
OKAG00839 96 Well

Ku70/XRCC6 Colorimetric Cell-Based ELISA Kit (OKAG00839)

Sign In for Pricing
View Details
Hamster Anti-Circulating histone 3 ELISA kit
GTR10476991 96 Well

Hamster Anti-Circulating histone 3 ELISA kit

Sign In for Pricing
View Details
TOPORS (Topoisomerase I Binding, Arginine/Serine-Rich, LUN, P53BP3, RP31, TP53BPL) (MaxLight 550)
252890-ML550 100 µL

TOPORS (Topoisomerase I Binding, Arginine/Serine-Rich, LUN, P53BP3, RP31, TP53BPL) (MaxLight 550)

Sign In for Pricing
View Details
UMODL1 Rabbit Polyclonal Antibody (FITC)
orb2119158 100 µL

UMODL1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Endothelin B Receptor (EDNRB) (NM_001122659) Human Tagged ORF Clone
RG225723 10 µg

Endothelin B Receptor (EDNRB) (NM_001122659) Human Tagged ORF Clone

Sign In for Pricing
View Details
Ku80 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-52512R-BF594 100 µL

Ku80 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details