What is the catalog number for Recombinant human G antigen 5?

The catalog number for Recombinant human G antigen 5 is OPCA00092-100UG.

What sizes are available for Recombinant human G antigen 5?

Recombinant human G antigen 5 is available in the following size(s): 100 µg.

Is Recombinant human G antigen 5 in stock?

Recombinant human G antigen 5 is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant human G antigen 5

Product Specifications

CAS Number

9000-83-3

Gene Name

G antigen 4|G antigen 5

Gene Aliases

Cancer/testis antigen 4.4; cancer/testis antigen 4.5; cancer/testis antigen family 4, member 4; cancer/testis antigen family 4, member 5; CT4.4; CT4.5; G antigen 4; G antigen 5; GAGE-4; GAGE-5.

Gene ID

2576|2577

Reactivity

Homo sapiens|Human

Target

Recombinant human G antigen 5

Type

Protein

Source

E.coli

Sequence

MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.