Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human G antigen 5

Product Specifications

CAS Number

9000-83-3

Gene Name

G antigen 4|G antigen 5

Gene Aliases

Cancer/testis antigen 4.4; cancer/testis antigen 4.5; cancer/testis antigen family 4, member 4; cancer/testis antigen family 4, member 5; CT4.4; CT4.5; G antigen 4; G antigen 5; GAGE-4; GAGE-5.

Gene ID

2576|2577

Reactivity

Homo sapiens|Human

Target

Recombinant human G antigen 5

Type

Protein

Source

E.coli

Sequence

MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GAGE4|GAGE5

Protein Name

G antigen 5

Gene Name URL

GAGE4|GAGE5

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli Protein AroM (aroM)
MBS1103957-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Protein AroM (aroM)

Sign In for Pricing
View Details
Recombinant Escherichia coli Protein AroM (aroM)
MBS1103957-02 0.1 mg (E-Coli)

Recombinant Escherichia coli Protein AroM (aroM)

Sign In for Pricing
View Details
Recombinant Escherichia coli Protein AroM (aroM)
MBS1103957-03 0.02 mg (Yeast)

Recombinant Escherichia coli Protein AroM (aroM)

Sign In for Pricing
View Details
Recombinant Escherichia coli Protein AroM (aroM)
MBS1103957-04 0.1 mg (Yeast)

Recombinant Escherichia coli Protein AroM (aroM)

Sign In for Pricing
View Details
Recombinant Escherichia coli Protein AroM (aroM)
MBS1103957-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli Protein AroM (aroM)

Sign In for Pricing
View Details
Recombinant Escherichia coli Protein AroM (aroM)
MBS1103957-06 0.02 mg (Mammalian-Cell)

Recombinant Escherichia coli Protein AroM (aroM)

Sign In for Pricing
View Details