Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Egl nine homolog 2

Product Specifications

CAS Number

9000-83-3

Gene Name

Egl-9 family hypoxia inducible factor 2

Gene Aliases

Egl nine homolog 2; EIT6; EIT-6; estrogen-induced tag 6; HIFPH1; HIF-PH1; HIF-prolyl hydroxylase 1; HPH-1; HPH-3; hypoxia-inducible factor prolyl hydroxylase 1; PHD1; prolyl hydroxylase domain-containing protein 1; prolyl hydroxylase EGLN2.

Gene ID

112398

Reactivity

Homo sapiens|Human

Target

Cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates a specific proline found in each of the oxygen-dependent degradation (ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A. Also hydroxylates HIF2A. Has a preference for the CODD site for both HIF1A and HIF2A. Hydroxylated HIFs are then targeted for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Under hypoxic conditions, the hydroxylation reaction is attenuated allowing HIFs to escape degradation resulting in their translocation to the nucleus, heterodimerization with HIF1B, and increased expression of hypoxy-inducible genes. EGLN2 is involved in regulating hypoxia tolerance and apoptosis in cardiac and skeletal muscle. Also regulates susceptibility to normoxic oxidative neuronal death. Links oxygen sensing to cell cycle and primary cilia formation by hydroxylating the critical centrosome component CEP192 which promotes its ubiquitination and subsequent proteasomal degradation. Hydroxylates IKBKB, mediating NF-kappaB activation in hypoxic conditions. Target proteins are preferentially recognized via a LXXLAP motif.

Type

Protein

Source

E.coli

Sequence

MVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

18.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

EGLN2

Protein Name

Egl nine homolog 2

Gene Name URL

EGLN2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adenylate kinase 4 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-62505R-BF350-01 20 µL

Adenylate kinase 4 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Adenylate kinase 4 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-62505R-BF350-02 100 µL

Adenylate kinase 4 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
AKTIP, CT (AKTIP, FTS, AKT-interacting protein, Ft1, Fused toes protein homolog) (MaxLight 550) discontinued
031761-ML550 100 µL

AKTIP, CT (AKTIP, FTS, AKT-interacting protein, Ft1, Fused toes protein homolog) (MaxLight 550) discontinued

Sign In for Pricing
View Details
FLASK,ERLENMEYER,500ML,BAFFLED,FLAT SEAL,S,IND,1/25
431408 1/pk

FLASK,ERLENMEYER,500ML,BAFFLED,FLAT SEAL,S,IND,1/25

Sign In for Pricing
View Details
Luc7l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3193008 1.0 µg DNA

Luc7l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
TET2 Protein Lysate (Human) with C-Ha Tag
46520031 100 µg

TET2 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details