Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Dermcidin

Product Specifications

CAS Number

9000-83-3

Gene Name

Dermcidin

Gene Aliases

AIDD; DCD-1; dermcidin; diffusible survival/evasion peptide; DSEP; HCAP; PIF; preproteolysin; proteolysis inducing factor; survival promoting peptide.

Gene ID

117159

Reactivity

Homo sapiens|Human

Target

DCD-1 displays antimicrobial activity thereby limiting skin infection by potential pathogens in the first few hours after bacterial colonization. Highly effective against E.coli, E.faecalis, S.aureus and C.albicans. Optimal pH and salt concentration resemble the conditions in sweat. Also exhibits proteolytic activity, cleaving on the C-terminal side of Arg and, to a lesser extent, Lys residues (PubMed:17448443) .

Type

Protein

Source

E.coli

Sequence

YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

36.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DCD

Protein Name

Dermcidin

Gene Name URL

DCD

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR4Q3, CT (OR4Q3, C14orf13, OR4Q4, Olfactory receptor 4Q3, Olfactory receptor 4Q4, Olfactory receptor OR14-3) (MaxLight 490)
MBS6328894-01 0.1 mL

OR4Q3, CT (OR4Q3, C14orf13, OR4Q4, Olfactory receptor 4Q3, Olfactory receptor 4Q4, Olfactory receptor OR14-3) (MaxLight 490)

Sign In for Pricing
View Details
OR4Q3, CT (OR4Q3, C14orf13, OR4Q4, Olfactory receptor 4Q3, Olfactory receptor 4Q4, Olfactory receptor OR14-3) (MaxLight 490)
MBS6328894-02 5x 0.1 mL

OR4Q3, CT (OR4Q3, C14orf13, OR4Q4, Olfactory receptor 4Q3, Olfactory receptor 4Q4, Olfactory receptor OR14-3) (MaxLight 490)

Sign In for Pricing
View Details
DCTN1 Protein Vector (Mouse) (pPM-C-His)
PV170893 500 ng

DCTN1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
N- (1- ((2S,4S,5R) -4-Hydroxy-5- (hydroxymethyl) tetrahydrofuran-2-yl) -2-oxo-1,2-dihydropyrimidin-4-yl) benzamide
OR1103190-01 25 mg

N- (1- ((2S,4S,5R) -4-Hydroxy-5- (hydroxymethyl) tetrahydrofuran-2-yl) -2-oxo-1,2-dihydropyrimidin-4-yl) benzamide

Sign In for Pricing
View Details
N- (1- ((2S,4S,5R) -4-Hydroxy-5- (hydroxymethyl) tetrahydrofuran-2-yl) -2-oxo-1,2-dihydropyrimidin-4-yl) benzamide
OR1103190-02 50 mg

N- (1- ((2S,4S,5R) -4-Hydroxy-5- (hydroxymethyl) tetrahydrofuran-2-yl) -2-oxo-1,2-dihydropyrimidin-4-yl) benzamide

Sign In for Pricing
View Details
N- (1- ((2S,4S,5R) -4-Hydroxy-5- (hydroxymethyl) tetrahydrofuran-2-yl) -2-oxo-1,2-dihydropyrimidin-4-yl) benzamide
OR1103190-03 100 mg

N- (1- ((2S,4S,5R) -4-Hydroxy-5- (hydroxymethyl) tetrahydrofuran-2-yl) -2-oxo-1,2-dihydropyrimidin-4-yl) benzamide

Sign In for Pricing
View Details