Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Acyl-CoA-binding protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Diazepam binding inhibitor, acyl-CoA binding protein

Gene Aliases

ACBD1; ACBP; acyl coenzyme A binding protein; acyl-CoA-binding protein; acyl-Coenzyme A binding domain containing 1; CCK-RP; cholecystokinin-releasing peptide, trypsin-sensitive; diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) ; diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein) ; diazepam-binding inhibitor; endozepine; EP; epididymis secretory sperm binding protein; GABA receptor modulator.

Gene ID

1622

Reactivity

Homo sapiens|Human

Target

Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.

Type

Protein

Source

E.coli

Sequence

WGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

15.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DBI

Protein Name

Acyl-CoA-binding protein

Gene Name URL

DBI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial (CYP27B1) ELISA Kit
EIA07018h 1 Kit

Human 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial (CYP27B1) ELISA Kit

Sign In for Pricing
View Details
HIV-1 p24 Protein
orb98892 1 mg

HIV-1 p24 Protein

Sign In for Pricing
View Details
Retinoic Acid Receptor beta (RARB) Human Over-expression Lysate
orb1356822 100 µg

Retinoic Acid Receptor beta (RARB) Human Over-expression Lysate

Sign In for Pricing
View Details
PCMV-COMMD1 (human) -3xFLAG-Neo
BZ54191 1 Vial

PCMV-COMMD1 (human) -3xFLAG-Neo

Sign In for Pricing
View Details
TAF I p48 Polyclonal Antibody
BT-AP08789-01 20 µL

TAF I p48 Polyclonal Antibody

Sign In for Pricing
View Details
TAF I p48 Polyclonal Antibody
BT-AP08789-02 50 µL

TAF I p48 Polyclonal Antibody

Sign In for Pricing
View Details