What is the catalog number for Recombinant human Acyl-CoA-binding protein?

The catalog number for Recombinant human Acyl-CoA-binding protein is OPCA00066-100UG.

What sizes are available for Recombinant human Acyl-CoA-binding protein?

Recombinant human Acyl-CoA-binding protein is available in the following size(s): 100 µg.

Is Recombinant human Acyl-CoA-binding protein in stock?

Recombinant human Acyl-CoA-binding protein is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant human Acyl-CoA-binding protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Diazepam binding inhibitor, acyl-CoA binding protein

Gene Aliases

ACBD1; ACBP; acyl coenzyme A binding protein; acyl-CoA-binding protein; acyl-Coenzyme A binding domain containing 1; CCK-RP; cholecystokinin-releasing peptide, trypsin-sensitive; diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) ; diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein) ; diazepam-binding inhibitor; endozepine; EP; epididymis secretory sperm binding protein; GABA receptor modulator.

Gene ID

1622

Reactivity

Homo sapiens|Human

Target

Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.

Type

Protein

Source

E.coli

Sequence

WGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.