Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Cytochrome c

Product Specifications

CAS Number

9000-83-3

Gene Name

Cytochrome c, somatic

Gene Aliases

CYC; cytochrome c; HCS; THC4.

Gene ID

54205

Reactivity

Homo sapiens|Human

Target

Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.

Type

Protein

Source

E.coli

Sequence

GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

Purification

Affinity purified using AC.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.1-5 mg/mL, by the Bradford Method

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CYCS

Protein Name

Cytochrome c

Gene Name URL

CYCS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Centrin 3 (CETN3) (NM_001297765) Human Untagged Clone
SC334330 10 µg

Centrin 3 (CETN3) (NM_001297765) Human Untagged Clone

Sign In for Pricing
View Details
P2RX7 Polyclonal Antibody, APC Conjugated
bs-12106R-APC 100 µL

P2RX7 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
CCKBR Human qPCR Template Standard (NM_176875)
HK201736 1 Kit

CCKBR Human qPCR Template Standard (NM_176875)

Sign In for Pricing
View Details
ALAS-E Rabbit Polyclonal Antibody (AP)
orb878466 100 µL

ALAS-E Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
LAPTM4A (KIAA0108, LAPTM4, MBNT, MTRP, Lysosomal-associated Transmembrane Protein 4A, Golgi 4-transmembrane-spanning Transporter MTP, UNQ1846/PRO3574, HUMORF13) (MaxLight 405) discontinued
138078-ML405 100 µL

LAPTM4A (KIAA0108, LAPTM4, MBNT, MTRP, Lysosomal-associated Transmembrane Protein 4A, Golgi 4-transmembrane-spanning Transporter MTP, UNQ1846/PRO3574, HUMORF13) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Anti-V5 Antibody (FITC)
60-5093 0.1 mg

Anti-V5 Antibody (FITC)

Sign In for Pricing
View Details