Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant rabbit Cathepsin K

Product Specifications

CAS Number

9000-83-3

Gene Name

Cathepsin K

Gene Aliases

Cathepsin K; OC-2; protein OC-2.

Gene ID

100009334

Reactivity

Oryctolagus cuniculus|Rabbit

Target

Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation.

Type

Protein

Source

E.coli

Sequence

TPDSIDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENYGCGGGYMTNAFQYVQRNRGIDSEDAYPYVGQDESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDENCSSDNVNHAVLAVGYGIQKGNKHWIIKNSWGESWGNKGYILMARNKNNACGIANLASFPKM

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

27.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CTSK

Protein Name

Cathepsin K

Gene Name URL

CTSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r25 (NM_001104641) Mouse Tagged ORF Clone
MR214197 10 µg

Vmn2r25 (NM_001104641) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse ADGRE1/EMR1 Polyclonal Antibody
E55A01947 100 µg

Mouse ADGRE1/EMR1 Polyclonal Antibody

Sign In for Pricing
View Details
NRCAM Polyclonal Antibody
UB-GEN-7061 100 µL

NRCAM Polyclonal Antibody

Sign In for Pricing
View Details
EREG 3'UTR Lenti-reporter-Luc Vector
19416081 1.0 µg

EREG 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
MhpE Antibody
orb818829 2 mg

MhpE Antibody

Sign In for Pricing
View Details
Dog hepsin F (CTSF) ELISA Kit
GTR10479252-01 48 Well

Dog hepsin F (CTSF) ELISA Kit

Sign In for Pricing
View Details