Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Collagen alpha-3 (IV) chain

Product Specifications

CAS Number

9000-83-3

Gene Name

Collagen type IV alpha 3 chain

Gene Aliases

ATS2; ATS3; collagen alpha-3 (IV) chain; collagen IV, alpha-3 polypeptide; collagen, type IV, alpha 3 (Goodpasture antigen) ; Goodpasture antigen; tumstatin.

Gene ID

1285

Reactivity

Homo sapiens|Human

Target

Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen.

Type

Protein

Source

E.coli

Sequence

GLKGKRGDSGSPATWTTRGFVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTMPFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIAIAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

COL4A3

Protein Name

Collagen alpha-3 (IV) chain

Gene Name URL

COL4A3

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal MAdCAM-1 Antibody (12B5)
NBP3-26157-50ul 50 µL

Rabbit Monoclonal MAdCAM-1 Antibody (12B5)

Sign In for Pricing
View Details
LentimiRa-Off-mmu-miR-7094-3p Vector
mm31735 500 ng

LentimiRa-Off-mmu-miR-7094-3p Vector

Sign In for Pricing
View Details
RIPK2 (Phospho-Tyr381) Antibody
MBS9429134-01 0.05 mL

RIPK2 (Phospho-Tyr381) Antibody

Sign In for Pricing
View Details
RIPK2 (Phospho-Tyr381) Antibody
MBS9429134-02 0.1 mL

RIPK2 (Phospho-Tyr381) Antibody

Sign In for Pricing
View Details
RIPK2 (Phospho-Tyr381) Antibody
MBS9429134-03 5x 0.1 mL

RIPK2 (Phospho-Tyr381) Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal BAF180/PB1 Antibody [Alexa Fluor 700]
NB100-79832AF700 0.1 mL

Rabbit Polyclonal BAF180/PB1 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details