Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Collagen alpha-3 (IV) chain

Product Specifications

CAS Number

9000-83-3

Gene Name

Collagen type IV alpha 3 chain

Gene Aliases

ATS2; ATS3; collagen alpha-3 (IV) chain; collagen IV, alpha-3 polypeptide; collagen, type IV, alpha 3 (Goodpasture antigen) ; Goodpasture antigen; tumstatin.

Gene ID

1285

Reactivity

Homo sapiens|Human

Target

Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen.

Type

Protein

Source

E.coli

Sequence

GLKGKRGDSGSPATWTTRGFVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTMPFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIAIAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

COL4A3

Protein Name

Collagen alpha-3 (IV) chain

Gene Name URL

COL4A3

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD123 antibody (DM33), Rabbit mAb
MBS9466699-01 0.01 mg

Anti-CD123 antibody (DM33), Rabbit mAb

Sign In for Pricing
View Details
Anti-CD123 antibody (DM33), Rabbit mAb
MBS9466699-02 0.1 mg

Anti-CD123 antibody (DM33), Rabbit mAb

Sign In for Pricing
View Details
Anti-CD123 antibody (DM33), Rabbit mAb
MBS9466699-03 5x 0.1 mg

Anti-CD123 antibody (DM33), Rabbit mAb

Sign In for Pricing
View Details
Mouse Monoclonal Influenza A H1N1 Nucleoprotein Antibody (GT1236) - (A/WSN/1933)
NBP3-13493 100 µL

Mouse Monoclonal Influenza A H1N1 Nucleoprotein Antibody (GT1236) - (A/WSN/1933)

Sign In for Pricing
View Details
Anti-CYP1A2 antibody
STJ92557 200 µl

Anti-CYP1A2 antibody

Sign In for Pricing
View Details
TID-1 HDR Plasmid (m)
sc-429955-HDR 20 µg

TID-1 HDR Plasmid (m)

Sign In for Pricing
View Details