Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Cerebellar degeneration-related protein 2

Product Specifications

CAS Number

9000-83-3

Gene Name

Cerebellar degeneration related protein 2

Gene Aliases

CDR62; cerebellar degeneration-related protein 2; cerebellar degeneration-related protein 2, 62kDa; major Yo paraneoplastic antigen; paraneoplastic cerebellar degeneration-associated antigen; Yo; Yo paraneoplastic antigen.

Gene ID

1039

Reactivity

Homo sapiens|Human

Target

Recombinant human Cerebellar degeneration-related protein 2

Type

Protein

Source

E.coli

Sequence

MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQQMYTTNQEQLQEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEIDEQRTKYRSLSSHS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

55.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CDR2

Protein Name

Cerebellar degeneration-related protein 2

Gene Name URL

CDR2

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRICKLE2 Protein Vector (Human) (pPB-C-His)
PV056645 500 ng

PRICKLE2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Abituzumab Biosimilar - Research Grade
ICH5138-20mg 20 mg

Abituzumab Biosimilar - Research Grade

Sign In for Pricing
View Details
CDK2 antibody
MBS830202-01 0.1 mL

CDK2 antibody

Sign In for Pricing
View Details
CDK2 antibody
MBS830202-02 5x 0.1 mL

CDK2 antibody

Sign In for Pricing
View Details
Foxi2 (NM_183193) Mouse Tagged Lenti ORF Clone
MR204836L3 10 µg

Foxi2 (NM_183193) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Phospho-AMPK alpha 1 (Ser486) Antibody
AF3422-01 100 µL

Phospho-AMPK alpha 1 (Ser486) Antibody

Sign In for Pricing
View Details