Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human CDKN2AIP N-terminal-like protein

Product Specifications

CAS Number

9000-83-3

Gene Name

CDKN2A interacting protein N-terminal like

Gene Aliases

C2AIL; CDKN2A-interacting protein N-terminal-like protein; CDKN2AIP N-terminal-like protein.

Gene ID

91368

Reactivity

Homo sapiens|Human

Target

Recombinant human CDKN2AIP N-terminal-like protein

Type

Protein

Source

E.coli

Sequence

MVGGEAAAAVEELVSGVRQAADFAEQFRSYSESEKQWKARMEFILRHLPDYRDPPDGSGRLDQLLSLSMVWANHLFLGCSYNKDLLDKVMEMADGIEVEDLPQFTTRSELMKKHQS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

17.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CDKN2AIPNL

Protein Name

CDKN2AIP N-terminal-like protein

Gene Name URL

CDKN2AIPNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C20orf132 Blocking Peptide
33R-7146 100 ug

C20orf132 Blocking Peptide

Sign In for Pricing
View Details
Tmem173 Antibody - C-terminal region : HRP (ARP59031_P050-HRP)
ARP59031_P050-HRP 100 µL

Tmem173 Antibody - C-terminal region : HRP (ARP59031_P050-HRP)

Sign In for Pricing
View Details
BC030867 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4950105 3x 1.0 µg

BC030867 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Lrig2 (NM_001107710) Rat Tagged ORF Clone
RR211082 10 µg

Lrig2 (NM_001107710) Rat Tagged ORF Clone

Sign In for Pricing
View Details
THA1P 3'UTR GFP Stable Cell Line
TU075511 1.0 mL

THA1P 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human Lymph Node Tissue Lysate 100ug
IHULYNTL100UG 100 µg

Human Lymph Node Tissue Lysate 100ug

Sign In for Pricing
View Details