Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human CDKN2AIP N-terminal-like protein

Product Specifications

CAS Number

9000-83-3

Gene Name

CDKN2A interacting protein N-terminal like

Gene Aliases

C2AIL; CDKN2A-interacting protein N-terminal-like protein; CDKN2AIP N-terminal-like protein.

Gene ID

91368

Reactivity

Homo sapiens|Human

Target

Recombinant human CDKN2AIP N-terminal-like protein

Type

Protein

Source

E.coli

Sequence

MVGGEAAAAVEELVSGVRQAADFAEQFRSYSESEKQWKARMEFILRHLPDYRDPPDGSGRLDQLLSLSMVWANHLFLGCSYNKDLLDKVMEMADGIEVEDLPQFTTRSELMKKHQS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

17.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CDKN2AIPNL

Protein Name

CDKN2AIP N-terminal-like protein

Gene Name URL

CDKN2AIPNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTDS-15-390 AF Systems Consumables
018684 Roll of 300 Plug-in Card

PTDS-15-390 AF Systems Consumables

Sign In for Pricing
View Details
Irgq Rat shRNA Plasmid (Locus ID 292708)
TR708976 1 Kit

Irgq Rat shRNA Plasmid (Locus ID 292708)

Sign In for Pricing
View Details
3-[ (4-Methyl-4H-1,2,4-triazol-3-yl) methyl]piperidin-3-ol dihydrochloride
KHD04130-01 50 mg

3-[ (4-Methyl-4H-1,2,4-triazol-3-yl) methyl]piperidin-3-ol dihydrochloride

Sign In for Pricing
View Details
3-[ (4-Methyl-4H-1,2,4-triazol-3-yl) methyl]piperidin-3-ol dihydrochloride
KHD04130-02 0.5 g

3-[ (4-Methyl-4H-1,2,4-triazol-3-yl) methyl]piperidin-3-ol dihydrochloride

Sign In for Pricing
View Details
TBRG4 (Transforming Growth Factor beta Regulator 4, CPR2, Cell Cycle Progression Restoration Protein 2, FASTKD4, KIAA0948) (MaxLight 550)
MBS6440022-01 0.1 mL

TBRG4 (Transforming Growth Factor beta Regulator 4, CPR2, Cell Cycle Progression Restoration Protein 2, FASTKD4, KIAA0948) (MaxLight 550)

Sign In for Pricing
View Details
TBRG4 (Transforming Growth Factor beta Regulator 4, CPR2, Cell Cycle Progression Restoration Protein 2, FASTKD4, KIAA0948) (MaxLight 550)
MBS6440022-02 5x 0.1 mL

TBRG4 (Transforming Growth Factor beta Regulator 4, CPR2, Cell Cycle Progression Restoration Protein 2, FASTKD4, KIAA0948) (MaxLight 550)

Sign In for Pricing
View Details