Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human CD59 glyco protein

Product Specifications

CAS Number

9000-83-3

Gene Name

CD59 molecule (CD59 blood group)

Gene Aliases

16.3A5;1F5;1F5 antigen;20 kDa homologous restriction factor; CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344) ; CD59 blood group antigen; CD59 glycoprotein; CD59 molecule, complement regulatory protein; EJ16; EJ30; EL32; G344; HRF20; HRF-20; human leukocyte antigen MIC11; Ly-6-like protein; lymphocytic antigen CD59/MEM43; MACIF; MAC-inhibitory protein; MAC-IP; MEM43; MEM43 antigen; membrane attack complex (MAC) inhibition factor; membrane attack complex inhibition factor; membrane inhibitor of reactive lysis; MIC11; MIN1; MIN2; MIN3; MIRL; MSK21; p18-20; protectin; surface anitgen recognized by monoclonal antibody 16.3A5; T cell-activating protein.

Gene ID

966

Reactivity

Homo sapiens|Human

Target

Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.

Type

Protein

Source

E.coli

Sequence

LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

36 kda

Protein Length

Recombinant

NCBI Gene Symbol

CD59

Protein Name

CD59 glycoprotein

Gene Name URL

CD59

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human CD69 CF
8468-CD-025 25 µg

Recombinant Human CD69 CF

Ask
View Details
FAM194A (ERICH6) Human shRNA Lentiviral Particle (Locus ID 131831)
TL305860V 500 µL Each

FAM194A (ERICH6) Human shRNA Lentiviral Particle (Locus ID 131831)

Ask
View Details
DDR2 Human shRNA Lentiviral Particle (Locus ID 4921)
TL320440V 500 µL Each

DDR2 Human shRNA Lentiviral Particle (Locus ID 4921)

Ask
View Details
Recombinant Cyanothece sp. Deoxyribose-phosphate aldolase (deoC)
MBS1172764-01 0.02 mg (E-Coli)

Recombinant Cyanothece sp. Deoxyribose-phosphate aldolase (deoC)

Ask
View Details
Recombinant Cyanothece sp. Deoxyribose-phosphate aldolase (deoC)
MBS1172764-02 0.1 mg (E-Coli)

Recombinant Cyanothece sp. Deoxyribose-phosphate aldolase (deoC)

Ask
View Details
Recombinant Cyanothece sp. Deoxyribose-phosphate aldolase (deoC)
MBS1172764-03 0.02 mg (Yeast)

Recombinant Cyanothece sp. Deoxyribose-phosphate aldolase (deoC)

Ask
View Details