Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Calreticulin

Product Specifications

CAS Number

9000-83-3

Gene Name

Calreticulin

Gene Aliases

Calregulin; calreticulin; CR; CRP55; CRT; endoplasmic reticulum resident protein 60; ERp60; HACBP.

Gene ID

12317

Reactivity

Mouse|Mus musculus

Target

Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis (By similarity) .

Type

Protein

Source

E.coli

Sequence

DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

Purification

Affinity purified using AC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

Varies by lot. See vial for exact concentration.

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

73.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Calr

Protein Name

Calreticulin

Gene Name URL

Calr

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Kcnk4 shRNA (UAS) - Lentiviral mouse Kcnk4 shRNA (UAS, iRFP) (100)
GTR15273471 1 Vial

Lentiviral mouse Kcnk4 shRNA (UAS) - Lentiviral mouse Kcnk4 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
SUMO2 Rabbit Polyclonal Antibody (C-term)
E28PB4335 100 µL

SUMO2 Rabbit Polyclonal Antibody (C-term)

Sign In for Pricing
View Details
Anti-SLC7A4 Antibody Picoband® PE Conjugated
A12638-3-PE 100 µg/Vial

Anti-SLC7A4 Antibody Picoband® PE Conjugated

Sign In for Pricing
View Details
ARRB1 (Arrestin 1 beta, ARB1, ARR1) (PE)
MBS6407300-01 0.1 mL

ARRB1 (Arrestin 1 beta, ARB1, ARR1) (PE)

Sign In for Pricing
View Details
ARRB1 (Arrestin 1 beta, ARB1, ARR1) (PE)
MBS6407300-02 5x 0.1 mL

ARRB1 (Arrestin 1 beta, ARB1, ARR1) (PE)

Sign In for Pricing
View Details
GATA1, Phosphorylated (S310) (GATA Binding Factor 1, GF1, GF-1, NFE1, XLTT, ERYF1, NF-E1, XLANP, XLTDA, GATA-1) (MaxLight 750)
MBS6418189-01 0.1 mL

GATA1, Phosphorylated (S310) (GATA Binding Factor 1, GF1, GF-1, NFE1, XLTT, ERYF1, NF-E1, XLANP, XLTDA, GATA-1) (MaxLight 750)

Sign In for Pricing
View Details