Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Anaphase-promoting complex subunit 15

Product Specifications

CAS Number

9000-83-3

Gene Name

Anaphase promoting complex subunit 15

Gene Aliases

Anaphase-promoting complex subunit 15; APC15; C11orf51; HSPC020.

Gene ID

25906

Reactivity

Homo sapiens|Human

Target

Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. In the complex, plays a role in the release of the mitotic checkpoint complex (MCC) from the APC/C: not required for APC/C activity itself, but promotes the turnover of CDC20 and MCC on the APC/C, thereby participating in the responsiveness of the spindle assembly checkpoint. Also required for degradation of CDC20.

Type

Protein

Source

E.coli

Sequence

MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

41.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ANAPC15

Protein Name

Anaphase-promoting complex subunit 15

Gene Name URL

ANAPC15

More Discoveries

Explore Other Products

Browse additional items from our catalog

nBu-PGA(100)[mPEG(20)]
VCar-Ly282 Inquire

nBu-PGA(100)[mPEG(20)]

Sign In for Pricing
View Details
PIRC91 3'UTR Lenti-reporter-Luc Vector
36832081 1.0 µg

PIRC91 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Mouse Anti-Survivin Antibody (anti-Surv) ELISA Kit
EIA05051m 1 Kit

Mouse Anti-Survivin Antibody (anti-Surv) ELISA Kit

Sign In for Pricing
View Details
IGSF21 Antibody Blocking Peptide
orb1500733 500 µg

IGSF21 Antibody Blocking Peptide

Sign In for Pricing
View Details
BCAP31 Polyclonal Antibody, FITC Conjugated
A51755-100 100 µL

BCAP31 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Recombinant Mouse Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 (Plod3)
MBS1417940-01 0.02 mg (E-Coli)

Recombinant Mouse Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 (Plod3)

Sign In for Pricing
View Details