Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Aldehyde oxidase

Product Specifications

CAS Number

9000-83-3

Gene Name

Aldehyde oxidase 1

Gene Aliases

Aldehyde oxidase; Aldehyde oxidase 1; AO; AOH1; azaheterocycle hydroxylase.

Gene ID

316

Reactivity

Homo sapiens|Human

Target

Oxidase with broad substrate specificity, oxidizing aromatic azaheterocycles, such as N1-methylnicotinamide, N-methylphthalazinium and phthalazine, as well as aldehydes, such as benzaldehyde, retinal, pyridoxal, and vanillin. Plays a key role in the metabolism of xenobiotics and drugs containing aromatic azaheterocyclic substituents. Participates in the bioactivation of prodrugs such as famciclovir, catalyzing the oxidation step from 6-deoxypenciclovir to penciclovir, which is a potent antiviral agent. Is probably involved in the regulation of reactive oxygen species homeostasis. May be a prominent source of superoxide generation via the one-electron reduction of molecular oxygen. Also may catalyze nitric oxide (NO) production via the reduction of nitrite to NO with NADH or aldehyde as electron donor. May play a role in adipogenesis.

Type

Protein

Source

E.coli

Sequence

FGSERMMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHAYNGLTLGAGLSLAQVKDILADVVQKLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSRK

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

24.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

AOX1

Protein Name

Aldehyde oxidase

Gene Name URL

AOX1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Kallikrein 11/KLK11 Antibody Picoband® Fluoro550 Conjugated
PA1631-Fluoro550 100 µg/Vial

Anti-Kallikrein 11/KLK11 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Gucy2g shRNA (UAS) - Lentiviral mouse Gucy2g shRNA (UAS, RFP) plasmid
GTR15260701 1 Vial

Lentiviral mouse Gucy2g shRNA (UAS) - Lentiviral mouse Gucy2g shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
RBM22 Polyclonal Antibody, Cy3 Conjugated
bs-19767R-Cy3 100 µL

RBM22 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
RPL23AP48 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
41173061 1.0 µg DNA

RPL23AP48 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Galectin 3 (GAL3) DIY ELISA Kit
MBS2163036-01 5x 96 Tests

Galectin 3 (GAL3) DIY ELISA Kit

Sign In for Pricing
View Details
Galectin 3 (GAL3) DIY ELISA Kit
MBS2163036-02 5x 96 Tests + MBS2089471 (Support Pack 1,5x 96 Tests)

Galectin 3 (GAL3) DIY ELISA Kit

Sign In for Pricing
View Details