Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Caveolin-3 (CAV3)

Product Specifications

Abbreviation

Recombinant Pig CAV3 protein

Gene Name

CAV3

UniProt

Q3ZDQ5

Expression Region

1-151aa

Organism

Sus scrofa (Pig)

Target Sequence

MMAEERTDLEAQIVKDIHFKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPVFAALGQVCSNIKVMLRKEV

Tag

N-terminal hFc-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Relevance

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. May also regulate voltage-gated potassium channels. Plays a role in the sarcolemma repair mechanism of both skeletal muscle and cardiomyocytes that permits rapid resealing of membranes disrupted by mechanical stress. Mediates the recruitment of CAVIN2 and CAVIN3 proteins to the caveolae.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

43.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Spectrin Beta, Non Erythrocytic 4 ELISA Kit
MBS099831-01 48 Well

Sheep Spectrin Beta, Non Erythrocytic 4 ELISA Kit

Sign In for Pricing
View Details
Sheep Spectrin Beta, Non Erythrocytic 4 ELISA Kit
MBS099831-02 96 Well

Sheep Spectrin Beta, Non Erythrocytic 4 ELISA Kit

Sign In for Pricing
View Details
Sheep Spectrin Beta, Non Erythrocytic 4 ELISA Kit
MBS099831-03 5x 96 Well

Sheep Spectrin Beta, Non Erythrocytic 4 ELISA Kit

Sign In for Pricing
View Details
Sheep Spectrin Beta, Non Erythrocytic 4 ELISA Kit
MBS099831-04 10x 96 Well

Sheep Spectrin Beta, Non Erythrocytic 4 ELISA Kit

Sign In for Pricing
View Details
Sulfur 50 ug/g (50 PPM) for AA and ICP 100mL in B100 Biofuel
BFS-50Y 100 g

Sulfur 50 ug/g (50 PPM) for AA and ICP 100mL in B100 Biofuel

Sign In for Pricing
View Details
SHROOM3 Antibody
MBS7045333-01 0.05 mg

SHROOM3 Antibody

Sign In for Pricing
View Details