AGR2 ELISA Kit (Human)
Product Specifications
CAS Number
7732-18-5
Gene Name
Anterior gradient 2, protein disulphide isomerase family member
Gene Aliases
AG2; AG-2; anterior gradient homolog 2; anterior gradient protein 2 homolog; epididymis secretory protein Li 116; GOB-4; HAG-2; HEL-S-116; HPC8; PDIA17; protein disulfide isomerase family A, member 17; secreted cement gland homolog; secreted cement gland protein XAG-2 homolog; XAG-2.
Gene ID
10551
Reactivity
Homo sapiens|Human
Target
Required for MUC2 post-transcriptional synthesis and secretion. May play a role in the production of mucus by intestinal cells (By similarity) . Proto-oncogene that may play a role in cell migration, cell differentiation and cell growth. Promotes cell adhesion (PubMed:23274113) .
Type
ELISA Kit
Sequence
MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
Applications
Enzyme-linked immunosorbent assay
Assay Principle
The microtiter plate provided in this kit has been pre-coated with an antibody specific to the index. Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody preparation specific to the index. Next, Avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. After TMB substrate solution is added, only those wells that contain the index, biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. The enzyme-substrate reaction is terminated by the addition of sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450nm +- 10nm. The concentration of the index in the samples is then determined by comparing the O.D. of the samples to the standard curve.
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions
Reconstitution & Storage Instructions
Western Blotting/Immunoblotting (WB/IB) Protocol
Western Blotting/Immunoblotting (WB/IB) Protocol
Immunohistochemistry (IHC) Protocol
Immunohistochemistry (IHC) Protocol
Immunocytochemistry (ICC) Protocol
Immunocytochemistry (ICC) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Blocking Peptide Competition Protocol (BPCP)
Blocking Peptide Competition Protocol (BPCP)
Immunoprecipitation (IP) Protocol
Immunoprecipitation (IP) Protocol
Antibody Array (AA) Protocol
Antibody Array (AA) Protocol
Sample Type
Serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.
Detection Range
0.156-10ng/mL
Recovery
Matrices listed below were spiked with certain level of recombinant the index and the recovery rates were calculated by comparing the measured value to the expected amount of the index in samples. Matrix Recovery range (%) Average (%) serum (n=5) 81-93 86 EDTA plasma (n=5) 80-97 88 heparin plasma (n=5) 90-101 95 Matrix Recovery range (%) Average (%) Matrix Recovery range (%) Average (%) Matrix Recovery range (%) Average (%) serum (n=5) 81-93 86 EDTA plasma (n=5) 80-97 88 heparin plasma (n=5) 90-101 95 serum (n=5) 81-93 86 serum (n=5) 81-93 86 EDTA plasma (n=5) 80-97 88 EDTA plasma (n=5) 80-97 88 heparin plasma (n=5) 90-101 95 heparin plasma (n=5) 90-101 95
Sensitivity
0.061ng/mL
NCBI Gene Symbol
AGR2
Protein Name
Anterior gradient protein 2 homolog
Gene Name URL
AGR2
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog