ACE ELISA Kit (Cow)
Product Specifications
CAS Number
7732-18-5
Gene Name
Angiotensin I converting enzyme
Gene Aliases
Angiotensin I converting enzyme (peptidyl-dipeptidase A) 1; angiotensin-converting enzyme; dipeptidyl carboxypeptidase I; kininase II.
Gene ID
509484
Reactivity
Bos taurus|Bovine
Type
ELISA Kit
Sequence
MGAASGRRSPPLLLPLLLLLLPPPPVILELDPALQPGNFPADEAGAQIFA
Applications
Enzyme-linked immunosorbent assay
Assay Principle
The microtiter plate provided in this kit has been pre-coated with an antibody specific to the index. Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody preparation specific to the index. Next, Avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. After TMB substrate solution is added, only those wells that contain the index, biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. The enzyme-substrate reaction is terminated by the addition of sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450nm +- 10nm. The concentration of the index in the samples is then determined by comparing the O.D. of the samples to the standard curve.
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions
Reconstitution & Storage Instructions
Western Blotting/Immunoblotting (WB/IB) Protocol
Western Blotting/Immunoblotting (WB/IB) Protocol
Immunohistochemistry (IHC) Protocol
Immunohistochemistry (IHC) Protocol
Immunocytochemistry (ICC) Protocol
Immunocytochemistry (ICC) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Blocking Peptide Competition Protocol (BPCP)
Blocking Peptide Competition Protocol (BPCP)
Immunoprecipitation (IP) Protocol
Immunoprecipitation (IP) Protocol
Antibody Array (AA) Protocol
Antibody Array (AA) Protocol
Sample Type
Serum, plasma or other biological fluids.
Detection Range
6.25-400ng/mL
Recovery
Matrices listed below were spiked with certain level of recombinant the index and the recovery rates were calculated by comparing the measured value to the expected amount of the index in samples. Matrix Recovery range (%) Average (%) serum (n=5) 81-93 86 EDTA plasma (n=5) 80-97 88 heparin plasma (n=5) 90-101 95 Matrix Recovery range (%) Average (%) Matrix Recovery range (%) Average (%) Matrix Recovery range (%) Average (%) serum (n=5) 81-93 86 EDTA plasma (n=5) 80-97 88 heparin plasma (n=5) 90-101 95 serum (n=5) 81-93 86 serum (n=5) 81-93 86 EDTA plasma (n=5) 80-97 88 EDTA plasma (n=5) 80-97 88 heparin plasma (n=5) 90-101 95 heparin plasma (n=5) 90-101 95
Sensitivity
2.15ng/mL
NCBI Gene Symbol
ACE
Protein Name
Angiotensin-converting enzyme
Gene Name URL
ACE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog