Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACE ELISA Kit (Cow)

Product Specifications

CAS Number

7732-18-5

Gene Name

Angiotensin I converting enzyme

Gene Aliases

Angiotensin I converting enzyme (peptidyl-dipeptidase A) 1; angiotensin-converting enzyme; dipeptidyl carboxypeptidase I; kininase II.

Gene ID

509484

Reactivity

Bos taurus|Bovine

Type

ELISA Kit

Sequence

MGAASGRRSPPLLLPLLLLLLPPPPVILELDPALQPGNFPADEAGAQIFA

Applications

Enzyme-linked immunosorbent assay

Assay Principle

The microtiter plate provided in this kit has been pre-coated with an antibody specific to the index. Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody preparation specific to the index. Next, Avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. After TMB substrate solution is added, only those wells that contain the index, biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. The enzyme-substrate reaction is terminated by the addition of sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450nm +- 10nm. The concentration of the index in the samples is then determined by comparing the O.D. of the samples to the standard curve.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Sample Type

Serum, plasma or other biological fluids.

Detection Range

6.25-400ng/mL

Recovery

Matrices listed below were spiked with certain level of recombinant the index and the recovery rates were calculated by comparing the measured value to the expected amount of the index in samples. Matrix Recovery range (%) Average (%) serum (n=5) 81-93 86 EDTA plasma (n=5) 80-97 88 heparin plasma (n=5) 90-101 95 Matrix Recovery range (%) Average (%) Matrix Recovery range (%) Average (%) Matrix Recovery range (%) Average (%) serum (n=5) 81-93 86 EDTA plasma (n=5) 80-97 88 heparin plasma (n=5) 90-101 95 serum (n=5) 81-93 86 serum (n=5) 81-93 86 EDTA plasma (n=5) 80-97 88 EDTA plasma (n=5) 80-97 88 heparin plasma (n=5) 90-101 95 heparin plasma (n=5) 90-101 95

Sensitivity

2.15ng/mL

NCBI Gene Symbol

ACE

Protein Name

Angiotensin-converting enzyme

Gene Name URL

ACE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL
BNC941045-100 1x 100 µL

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF488A conjugate, 0.1mg/mL
BNC881052-500 1x 500 µL

CD3e (B-B12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF740 conjugate, 0.1mg/mL
BNC740449-100 1x 100 µL

CD104 (UM-A9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (DF-T1), CF740 conjugate, 0.1mg/mL
BNC740027-500 1x 500 µL

CD43 (DF-T1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (BP53-12), CF568 conjugate, 0.1mg/mL
BNC680013-500 1x 500 µL

P53 (BP53-12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details