PPAR alpha, Human (His)
PPAR alpha Protein, human (His), a member of the nuclear receptor family, is a transcription factor that regulates the expression of genes related to lipid metabolism in a ligand-dependent manner.
Product Specifications
Product Name Alternative
PPAR alpha Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ppar-alpha-protein--human-his.html
Purity
95.0
Smiles
DLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
Molecular Formula
5465 (Gene_ID) Q07869-1 (D202-Y468) (Accession)
Molecular Weight
Approximately 32.5kDa
References & Citations
[1]Takuji Oyama, et al. Crystal Structures of the Human Peroxisome Proliferator-Activated Receptor (PPAR) α Ligand-Binding Domain in Complexes with a Series of Phenylpropanoic Acid Derivatives Generated by a Ligand-Exchange Soaking Method. Biol Pharm Bull. 2021;44 (9) :1202-1209.
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV725476 1.0 µg DNA
FND Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
Sign In for Pricing
View Details AMM00081G 0.05mg
Monoclonal Complement 4d (C4d) (Acute Humoral Rejection Marker) Antibody - With BSA and Azide, Clone: C4D204
Sign In for Pricing
View Details