PPAR alpha, Human (His)
PPAR alpha Protein, human (His), a member of the nuclear receptor family, is a transcription factor that regulates the expression of genes related to lipid metabolism in a ligand-dependent manner.
Product Specifications
Product Name Alternative
PPAR alpha Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ppar-alpha-protein--human-his.html
Purity
95.0
Smiles
DLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
Molecular Formula
5465 (Gene_ID) Q07869-1 (D202-Y468) (Accession)
Molecular Weight
Approximately 32.5kDa
References & Citations
[1]Takuji Oyama, et al. Crystal Structures of the Human Peroxisome Proliferator-Activated Receptor (PPAR) α Ligand-Binding Domain in Complexes with a Series of Phenylpropanoic Acid Derivatives Generated by a Ligand-Exchange Soaking Method. Biol Pharm Bull. 2021;44 (9) :1202-1209.
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb501080 100 µL
Phospho-alpha Adducin (Ser726) Rabbit Polyclonal Antibody (Biotin)
Sign In for Pricing
View Details ![Mouse Monoclonal TLR9 Antibody (26C593R) [DyLight 550]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
FAB36583L 0.1 mL
Mouse Monoclonal TLR9 Antibody (26C593R) [DyLight 550]
Sign In for Pricing
View Details 
AFG-ELL-3171 > 5x 10^5 Cells / Vial
Human Cerebrovascular Outer Membrane Fibroblasts
Sign In for Pricing
View Details