Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPAR alpha, Human (His)

PPAR alpha Protein, human (His), a member of the nuclear receptor family, is a transcription factor that regulates the expression of genes related to lipid metabolism in a ligand-dependent manner.

Product Specifications

Product Name Alternative

PPAR alpha Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ppar-alpha-protein--human-his.html

Purity

95.0

Smiles

DLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY

Molecular Formula

5465 (Gene_ID) Q07869-1 (D202-Y468) (Accession)

Molecular Weight

Approximately 32.5kDa

References & Citations

[1]Takuji Oyama, et al. Crystal Structures of the Human Peroxisome Proliferator-Activated Receptor (PPAR) α Ligand-Binding Domain in Complexes with a Series of Phenylpropanoic Acid Derivatives Generated by a Ligand-Exchange Soaking Method. Biol Pharm Bull. 2021;44 (9) :1202-1209.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHST14 Antibody
A63393-100UG 100 µg

CHST14 Antibody

Sign In for Pricing
View Details
Bromelain 2400 GDU/gram
B18150-01 25 g

Bromelain 2400 GDU/gram

Sign In for Pricing
View Details
Bromelain 2400 GDU/gram
B18150-02 100 g

Bromelain 2400 GDU/gram

Sign In for Pricing
View Details
1-Tridecanesulfonic Acid Sodium Salt
T20835 1 g

1-Tridecanesulfonic Acid Sodium Salt

Sign In for Pricing
View Details
Optimedin (OLFM3) (NM_058170) Human Over-expression Lysate
LH13403V 100 µg

Optimedin (OLFM3) (NM_058170) Human Over-expression Lysate

Sign In for Pricing
View Details
(2S,3R,4S,5S,6S) -2- (4- (Hydroxymethyl) -2-nitrophenoxy) -6- (methoxycarbonyl) tetrahydro-2H-pyran-3,4,5-triyl triacetate
YFA57994-01 1 g

(2S,3R,4S,5S,6S) -2- (4- (Hydroxymethyl) -2-nitrophenoxy) -6- (methoxycarbonyl) tetrahydro-2H-pyran-3,4,5-triyl triacetate

Sign In for Pricing
View Details