Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPA1, Human (His)

The HNRNPA1 protein is complexly involved in multiple RNA processing functions, packaging pre-mRNA into hnRNP particles, promoting Poly (A) mRNA transport, and regulating splice site selection. Crucially, it binds inhibitoryly to sequences flanking PKM exon 9, favoring the inclusion of exon 10 in pyruvate kinase PKM splicing, thereby generating the PKM M2 isoform. HNRNPA1 Protein, Human (His) is the recombinant human-derived HNRNPA1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HNRNPA1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hnrnpa1-protein-human-his.html

Purity

90.0

Smiles

SKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ

Molecular Formula

3178 (Gene_ID) P09651-1 (S2-Q354) (Accession)

Molecular Weight

Approximately 40.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Glucose-6-phosphate Isomerase, GPI ELISA Kit
MBS1608345-01 48 Well

Sheep Glucose-6-phosphate Isomerase, GPI ELISA Kit

Sign In for Pricing
View Details
Sheep Glucose-6-phosphate Isomerase, GPI ELISA Kit
MBS1608345-02 96 Well

Sheep Glucose-6-phosphate Isomerase, GPI ELISA Kit

Sign In for Pricing
View Details
Sheep Glucose-6-phosphate Isomerase, GPI ELISA Kit
MBS1608345-03 5x 96 Well

Sheep Glucose-6-phosphate Isomerase, GPI ELISA Kit

Sign In for Pricing
View Details
Sheep Glucose-6-phosphate Isomerase, GPI ELISA Kit
MBS1608345-04 10x 96 Well

Sheep Glucose-6-phosphate Isomerase, GPI ELISA Kit

Sign In for Pricing
View Details
Human Myosin Light Chain 9, Regulatory (MYL9) ELISA Kit
EKU06108 96 Tests

Human Myosin Light Chain 9, Regulatory (MYL9) ELISA Kit

Sign In for Pricing
View Details
Cat Atrial Natriuretic Peptide ELISA Kit
MBS064945-01 48 Well

Cat Atrial Natriuretic Peptide ELISA Kit

Sign In for Pricing
View Details