Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPA1, Human (His)

The HNRNPA1 protein is complexly involved in multiple RNA processing functions, packaging pre-mRNA into hnRNP particles, promoting Poly (A) mRNA transport, and regulating splice site selection. Crucially, it binds inhibitoryly to sequences flanking PKM exon 9, favoring the inclusion of exon 10 in pyruvate kinase PKM splicing, thereby generating the PKM M2 isoform. HNRNPA1 Protein, Human (His) is the recombinant human-derived HNRNPA1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HNRNPA1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hnrnpa1-protein-human-his.html

Purity

90.0

Smiles

SKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ

Molecular Formula

3178 (Gene_ID) P09651-1 (S2-Q354) (Accession)

Molecular Weight

Approximately 40.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR4G11P sgRNA CRISPR Lentivector (Human) (Target 3)
K1510304 1.0 µg DNA

OR4G11P sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Anti-TCEB2  (2B4)
YF-MA15756 100 ug

Anti-TCEB2 (2B4)

Sign In for Pricing
View Details
IGSF3 (NM_001007237) Human Tagged Lenti ORF Clone
RC221769L4 10 µg

IGSF3 (NM_001007237) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Bacteroides fragilis Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA), partial
MBS7079064 Inquire

Recombinant Bacteroides fragilis Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA), partial

Sign In for Pricing
View Details
RPL26P37 3'UTR Luciferase Stable Cell Line
TU021202 1.0 mL

RPL26P37 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Ticam1 Pre-designed siRNA Set A
SI114597A 1 Each

Mouse Ticam1 Pre-designed siRNA Set A

Sign In for Pricing
View Details