Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPA1, Human (His)

The HNRNPA1 protein is complexly involved in multiple RNA processing functions, packaging pre-mRNA into hnRNP particles, promoting Poly (A) mRNA transport, and regulating splice site selection. Crucially, it binds inhibitoryly to sequences flanking PKM exon 9, favoring the inclusion of exon 10 in pyruvate kinase PKM splicing, thereby generating the PKM M2 isoform. HNRNPA1 Protein, Human (His) is the recombinant human-derived HNRNPA1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HNRNPA1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hnrnpa1-protein-human-his.html

Purity

90.0

Smiles

SKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ

Molecular Formula

3178 (Gene_ID) P09651-1 (S2-Q354) (Accession)

Molecular Weight

Approximately 40.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutathione S-Transferase A3 (GSTA3) Peptide
abx617378 100 µg

Glutathione S-Transferase A3 (GSTA3) Peptide

Sign In for Pricing
View Details
Mouse SLAIN2 siRNA
abx933475-01 15 nmol

Mouse SLAIN2 siRNA

Sign In for Pricing
View Details
Mouse SLAIN2 siRNA
abx933475-02 30 nmol

Mouse SLAIN2 siRNA

Sign In for Pricing
View Details
CYCSP41 ORF Vector (Human) (pORF)
ORF017933 1.0 µg DNA

CYCSP41 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Vmn1r112 (NM_001166847) Mouse Tagged ORF Clone Lentiviral Particle
MR224687L3V 200 µL

Vmn1r112 (NM_001166847) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Eye syndrome critical region protein 6 (CECR6) Mouse ELISA Kit
D3065 96 Tests

Eye syndrome critical region protein 6 (CECR6) Mouse ELISA Kit

Sign In for Pricing
View Details