Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPA1, Human (His)

The HNRNPA1 protein is complexly involved in multiple RNA processing functions, packaging pre-mRNA into hnRNP particles, promoting Poly (A) mRNA transport, and regulating splice site selection. Crucially, it binds inhibitoryly to sequences flanking PKM exon 9, favoring the inclusion of exon 10 in pyruvate kinase PKM splicing, thereby generating the PKM M2 isoform. HNRNPA1 Protein, Human (His) is the recombinant human-derived HNRNPA1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HNRNPA1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hnrnpa1-protein-human-his.html

Purity

90.0

Smiles

SKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ

Molecular Formula

3178 (Gene_ID) P09651-1 (S2-Q354) (Accession)

Molecular Weight

Approximately 40.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-FLRT3 Antibody
CTA1546-01 30 µL

Anti-FLRT3 Antibody

Sign In for Pricing
View Details
Anti-FLRT3 Antibody
CTA1546-02 50 μL

Anti-FLRT3 Antibody

Sign In for Pricing
View Details
Anti-FLRT3 Antibody
CTA1546-03 100 µL

Anti-FLRT3 Antibody

Sign In for Pricing
View Details
Anti-FLRT3 Antibody
CTA1546-04 200 µL

Anti-FLRT3 Antibody

Sign In for Pricing
View Details
Human Erythropoietin R MAb (Clone 38407)
MAB3071-500 500 µg

Human Erythropoietin R MAb (Clone 38407)

Sign In for Pricing
View Details
Cadherin-5, 25-599aa, Mouse, His tag, Insect cell
E53A01400 50 µg

Cadherin-5, 25-599aa, Mouse, His tag, Insect cell

Sign In for Pricing
View Details