Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPA1, Human (His)

The HNRNPA1 protein is complexly involved in multiple RNA processing functions, packaging pre-mRNA into hnRNP particles, promoting Poly (A) mRNA transport, and regulating splice site selection. Crucially, it binds inhibitoryly to sequences flanking PKM exon 9, favoring the inclusion of exon 10 in pyruvate kinase PKM splicing, thereby generating the PKM M2 isoform. HNRNPA1 Protein, Human (His) is the recombinant human-derived HNRNPA1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HNRNPA1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hnrnpa1-protein-human-his.html

Purity

90.0

Smiles

SKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ

Molecular Formula

3178 (Gene_ID) P09651-1 (S2-Q354) (Accession)

Molecular Weight

Approximately 40.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal LRP10 Antibody
NBP1-84159-25ul 25 µL

Rabbit Polyclonal LRP10 Antibody

Sign In for Pricing
View Details
LRG1 Recombinant Rabbit Monoclonal Antibody [JB34-31]
ET7107-11 100 µL

LRG1 Recombinant Rabbit Monoclonal Antibody [JB34-31]

Sign In for Pricing
View Details
Mitoferrin 2/SLC25A28 Polyclonal Antibody, RBITC Conjugated
bs-7157R-RBITC 100 µL

Mitoferrin 2/SLC25A28 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
ADAMTS-2 (F-4) Alexa Fluor® 488
sc-393562 AF488 200 µg/mL

ADAMTS-2 (F-4) Alexa Fluor® 488

Sign In for Pricing
View Details
TRNAM11 sgRNA CRISPR Lentivector (Human) (Target 1)
K2505502 1.0 µg DNA

TRNAM11 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Mouse Anti-ALDH1A1 Recombinant Antibody (ZG-0279F)
ZG-0279F Each

Mouse Anti-ALDH1A1 Recombinant Antibody (ZG-0279F)

Sign In for Pricing
View Details