Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPA1, Human (His)

The HNRNPA1 protein is complexly involved in multiple RNA processing functions, packaging pre-mRNA into hnRNP particles, promoting Poly (A) mRNA transport, and regulating splice site selection. Crucially, it binds inhibitoryly to sequences flanking PKM exon 9, favoring the inclusion of exon 10 in pyruvate kinase PKM splicing, thereby generating the PKM M2 isoform. HNRNPA1 Protein, Human (His) is the recombinant human-derived HNRNPA1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HNRNPA1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hnrnpa1-protein-human-his.html

Purity

90.0

Smiles

SKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ

Molecular Formula

3178 (Gene_ID) P09651-1 (S2-Q354) (Accession)

Molecular Weight

Approximately 40.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSPAN4 Rabbit pAb (APR17877N)
APR17877N-01 50 µL

TSPAN4 Rabbit pAb (APR17877N)

Sign In for Pricing
View Details
TSPAN4 Rabbit pAb (APR17877N)
APR17877N-02 100 µL

TSPAN4 Rabbit pAb (APR17877N)

Sign In for Pricing
View Details
TSPAN4 Rabbit pAb (APR17877N)
APR17877N-03 200 µL

TSPAN4 Rabbit pAb (APR17877N)

Sign In for Pricing
View Details
Lentiviral human RABAC1 shRNA (UAS) - Lentiviral human RABAC1 shRNA (UAS) (25)
GTR15295148 1 Vial

Lentiviral human RABAC1 shRNA (UAS) - Lentiviral human RABAC1 shRNA (UAS) (25)

Sign In for Pricing
View Details
TBC1D12 CRISPR Activation Plasmid (h)
sc-409239-ACT 20 µg

TBC1D12 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
RGL4 Lentiviral Activation Particles (h2)
sc-406419-LAC-2 200 µL

RGL4 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details