Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPA1, Human (His)

The HNRNPA1 protein is complexly involved in multiple RNA processing functions, packaging pre-mRNA into hnRNP particles, promoting Poly (A) mRNA transport, and regulating splice site selection. Crucially, it binds inhibitoryly to sequences flanking PKM exon 9, favoring the inclusion of exon 10 in pyruvate kinase PKM splicing, thereby generating the PKM M2 isoform. HNRNPA1 Protein, Human (His) is the recombinant human-derived HNRNPA1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HNRNPA1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hnrnpa1-protein-human-his.html

Purity

90.0

Smiles

SKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ

Molecular Formula

3178 (Gene_ID) P09651-1 (S2-Q354) (Accession)

Molecular Weight

Approximately 40.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2D2 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-8348R-BF488 100 µL

UBE2D2 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
SEC62 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-62824R-BF750-01 20 µL

SEC62 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
SEC62 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-62824R-BF750-02 100 µL

SEC62 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Human Epha3 (Ephrin Type A Receptor 3) ELISA Kit
FY-EH2442 96 Well

Human Epha3 (Ephrin Type A Receptor 3) ELISA Kit

Sign In for Pricing
View Details
Prolactin Receptor, acetylated (Lys505) (PRL-R, PRLR) (MaxLight 405) discontinued
029591-ML405 100 µL

Prolactin Receptor, acetylated (Lys505) (PRL-R, PRLR) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal LEMD3 Antibody (OTI6C10) - Azide and BSA Free
NBP2-71744 100 µg

Mouse Monoclonal LEMD3 Antibody (OTI6C10) - Azide and BSA Free

Sign In for Pricing
View Details