Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPA1, Human (His)

The HNRNPA1 protein is complexly involved in multiple RNA processing functions, packaging pre-mRNA into hnRNP particles, promoting Poly (A) mRNA transport, and regulating splice site selection. Crucially, it binds inhibitoryly to sequences flanking PKM exon 9, favoring the inclusion of exon 10 in pyruvate kinase PKM splicing, thereby generating the PKM M2 isoform. HNRNPA1 Protein, Human (His) is the recombinant human-derived HNRNPA1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HNRNPA1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hnrnpa1-protein-human-his.html

Purity

90.0

Smiles

SKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ

Molecular Formula

3178 (Gene_ID) P09651-1 (S2-Q354) (Accession)

Molecular Weight

Approximately 40.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LCN2 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV687906 1.0 µg DNA

LCN2 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
SAMD14 Antibody
GWB-MT016G 50 µg

SAMD14 Antibody

Sign In for Pricing
View Details
A630033H20Rik Protein Vector (Mouse) (pPB-N-His)
PV150747 500 ng

A630033H20Rik Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Ifi47 (NM_008330) Mouse Tagged ORF Clone Lentiviral Particle
MR206684L4V 200 µL

Ifi47 (NM_008330) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Olr1165 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7204804 1.0 µg DNA

Olr1165 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Human Acute Megakaryocytic Leukemia Cells [CMK]
AFG-ELL-2834 > 1x 10^6 Cells / Vial

Human Acute Megakaryocytic Leukemia Cells [CMK]

Sign In for Pricing
View Details