Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPA1, Human (His)

The HNRNPA1 protein is complexly involved in multiple RNA processing functions, packaging pre-mRNA into hnRNP particles, promoting Poly (A) mRNA transport, and regulating splice site selection. Crucially, it binds inhibitoryly to sequences flanking PKM exon 9, favoring the inclusion of exon 10 in pyruvate kinase PKM splicing, thereby generating the PKM M2 isoform. HNRNPA1 Protein, Human (His) is the recombinant human-derived HNRNPA1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HNRNPA1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hnrnpa1-protein-human-his.html

Purity

90.0

Smiles

SKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ

Molecular Formula

3178 (Gene_ID) P09651-1 (S2-Q354) (Accession)

Molecular Weight

Approximately 40.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMEM179 Knockout HEK293T cell line
GTR15403186 1 Vial

Human TMEM179 Knockout HEK293T cell line

Sign In for Pricing
View Details
Normal Rat IgG Control
6-001-A 1 mg

Normal Rat IgG Control

Sign In for Pricing
View Details
Mouse GAD1 (Glutamate Decarboxylase 1, Brain) ELISA Kit
ELK7113-01 48 Tests

Mouse GAD1 (Glutamate Decarboxylase 1, Brain) ELISA Kit

Sign In for Pricing
View Details
Mouse GAD1 (Glutamate Decarboxylase 1, Brain) ELISA Kit
ELK7113-02 96 Tests

Mouse GAD1 (Glutamate Decarboxylase 1, Brain) ELISA Kit

Sign In for Pricing
View Details
Mouse GAD1 (Glutamate Decarboxylase 1, Brain) ELISA Kit
ELK7113-03 5x 96 Tests

Mouse GAD1 (Glutamate Decarboxylase 1, Brain) ELISA Kit

Sign In for Pricing
View Details
TREM1 (Triggering Receptor Expressed on Myeloid Cells 1, TREM-1) (Biotin)
MBS6441656-01 0.1 mL

TREM1 (Triggering Receptor Expressed on Myeloid Cells 1, TREM-1) (Biotin)

Sign In for Pricing
View Details