Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPA1, Human (His)

The HNRNPA1 protein is complexly involved in multiple RNA processing functions, packaging pre-mRNA into hnRNP particles, promoting Poly (A) mRNA transport, and regulating splice site selection. Crucially, it binds inhibitoryly to sequences flanking PKM exon 9, favoring the inclusion of exon 10 in pyruvate kinase PKM splicing, thereby generating the PKM M2 isoform. HNRNPA1 Protein, Human (His) is the recombinant human-derived HNRNPA1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HNRNPA1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hnrnpa1-protein-human-his.html

Purity

90.0

Smiles

SKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ

Molecular Formula

3178 (Gene_ID) P09651-1 (S2-Q354) (Accession)

Molecular Weight

Approximately 40.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr656 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4310007 1.0 µg DNA

Olfr656 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal CBP/KAT3A Antibody [DyLight 350]
NB100-381UV 0.1 mL

Rabbit Polyclonal CBP/KAT3A Antibody [DyLight 350]

Sign In for Pricing
View Details
5-Acetyl-2H-pyrazole-3-carboxylic Acid Ethyl Ester
TRC-A192803-50MG 50 mg

5-Acetyl-2H-pyrazole-3-carboxylic Acid Ethyl Ester

Sign In for Pricing
View Details
Polyclonal JPH4 Antibody
AMM06044G 0.1 mg

Polyclonal JPH4 Antibody

Sign In for Pricing
View Details
Anti-PSMB6 Polyclonal Antibody
HB012014-01 50 µg

Anti-PSMB6 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-PSMB6 Polyclonal Antibody
HB012014-02 100 µg

Anti-PSMB6 Polyclonal Antibody

Sign In for Pricing
View Details