Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPA1, Human (His)

The HNRNPA1 protein is complexly involved in multiple RNA processing functions, packaging pre-mRNA into hnRNP particles, promoting Poly (A) mRNA transport, and regulating splice site selection. Crucially, it binds inhibitoryly to sequences flanking PKM exon 9, favoring the inclusion of exon 10 in pyruvate kinase PKM splicing, thereby generating the PKM M2 isoform. HNRNPA1 Protein, Human (His) is the recombinant human-derived HNRNPA1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HNRNPA1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hnrnpa1-protein-human-his.html

Purity

90.0

Smiles

SKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ

Molecular Formula

3178 (Gene_ID) P09651-1 (S2-Q354) (Accession)

Molecular Weight

Approximately 40.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASCC2 antibody
MBS830464-01 0.1 mL

ASCC2 antibody

Sign In for Pricing
View Details
ASCC2 antibody
MBS830464-02 5x 0.1 mL

ASCC2 antibody

Sign In for Pricing
View Details
Neuralized-Like protein 1A (NEURL) Mouse ELISA Kit
F3160 96 Tests

Neuralized-Like protein 1A (NEURL) Mouse ELISA Kit

Sign In for Pricing
View Details
MIR1181 ORF Vector (Human) (pORF)
ORF023577 1.0 µg DNA

MIR1181 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Ctf2 Recombinant Protein
PPT-16475 100 µg

Mouse Ctf2 Recombinant Protein

Sign In for Pricing
View Details
Lentiviral mouse Greb1l shRNA (UAS) - Lentiviral mouse Greb1l shRNA (UAS, GFP) plasmid
GTR15183886 1 Vial

Lentiviral mouse Greb1l shRNA (UAS) - Lentiviral mouse Greb1l shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details