Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPA1, Human (His)

The HNRNPA1 protein is complexly involved in multiple RNA processing functions, packaging pre-mRNA into hnRNP particles, promoting Poly (A) mRNA transport, and regulating splice site selection. Crucially, it binds inhibitoryly to sequences flanking PKM exon 9, favoring the inclusion of exon 10 in pyruvate kinase PKM splicing, thereby generating the PKM M2 isoform. HNRNPA1 Protein, Human (His) is the recombinant human-derived HNRNPA1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HNRNPA1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hnrnpa1-protein-human-his.html

Purity

90.0

Smiles

SKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ

Molecular Formula

3178 (Gene_ID) P09651-1 (S2-Q354) (Accession)

Molecular Weight

Approximately 40.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Ovalbumin Antibody (2C6) [DyLight 350]
NB100-62809UV 0.1 mL

Mouse Monoclonal Ovalbumin Antibody (2C6) [DyLight 350]

Sign In for Pricing
View Details
OR4F5 Protein Vector (Human) (pPB-C-His)
PV107122 500 ng

OR4F5 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
PISD sgRNA CRISPR Lentivector set (Human)
K1653301 3x 1.0 µg

PISD sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
anti-PLOD3
YF-PA16006 50 ug

anti-PLOD3

Sign In for Pricing
View Details
Soil Available Boron Content Assay Kit
AK0158-100T-96S 100 Tests - 96 Samples

Soil Available Boron Content Assay Kit

Sign In for Pricing
View Details
NR1D2 Polyclonal Antibody
ANT-13515-50ug 50 µg

NR1D2 Polyclonal Antibody

Sign In for Pricing
View Details