Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPA1, Human (His)

The HNRNPA1 protein is complexly involved in multiple RNA processing functions, packaging pre-mRNA into hnRNP particles, promoting Poly (A) mRNA transport, and regulating splice site selection. Crucially, it binds inhibitoryly to sequences flanking PKM exon 9, favoring the inclusion of exon 10 in pyruvate kinase PKM splicing, thereby generating the PKM M2 isoform. HNRNPA1 Protein, Human (His) is the recombinant human-derived HNRNPA1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HNRNPA1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hnrnpa1-protein-human-his.html

Purity

90.0

Smiles

SKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ

Molecular Formula

3178 (Gene_ID) P09651-1 (S2-Q354) (Accession)

Molecular Weight

Approximately 40.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cops4 (NM_001004275) Rat Untagged Clone
RN213105 10 µg

Cops4 (NM_001004275) Rat Untagged Clone

Sign In for Pricing
View Details
LOC100365292 3'UTR GFP Stable Cell Line
TU259465 1.0 mL

LOC100365292 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Scramblase 1 Recombinant Antibody, APC-Cy7 Conjugated
bsm-62122R-APC-Cy7 100 µL

Scramblase 1 Recombinant Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Mouse Anti-Chicken Major Histocompatibility Complex (MHC) Class I Monoclonal Antibody-[Biotin]
VD7N305 1 Each

Mouse Anti-Chicken Major Histocompatibility Complex (MHC) Class I Monoclonal Antibody-[Biotin]

Sign In for Pricing
View Details
Ankrd34c (NM_001106845) Rat Tagged Lenti ORF Clone
RR206412L4 10 µg

Ankrd34c (NM_001106845) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
BTK (NM_000061) Human Mutant ORF Clone
RC400798 10 µg

BTK (NM_000061) Human Mutant ORF Clone

Sign In for Pricing
View Details