Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPA1, Human (His)

The HNRNPA1 protein is complexly involved in multiple RNA processing functions, packaging pre-mRNA into hnRNP particles, promoting Poly (A) mRNA transport, and regulating splice site selection. Crucially, it binds inhibitoryly to sequences flanking PKM exon 9, favoring the inclusion of exon 10 in pyruvate kinase PKM splicing, thereby generating the PKM M2 isoform. HNRNPA1 Protein, Human (His) is the recombinant human-derived HNRNPA1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HNRNPA1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hnrnpa1-protein-human-his.html

Purity

90.0

Smiles

SKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ

Molecular Formula

3178 (Gene_ID) P09651-1 (S2-Q354) (Accession)

Molecular Weight

Approximately 40.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ammonium Ceric Sulphate Dihydrate 98% Extrapure
00196 00500 500 g

Ammonium Ceric Sulphate Dihydrate 98% Extrapure

Sign In for Pricing
View Details
MPP1 (NM_002436) Human Tagged Lenti ORF Clone
RC201754L3 10 µg

MPP1 (NM_002436) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit anti-human Napsin-A polyclonal Antibody, Biotin conjugated
MBS1488357-01 0.05 mg

Rabbit anti-human Napsin-A polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human Napsin-A polyclonal Antibody, Biotin conjugated
MBS1488357-02 0.1 mg

Rabbit anti-human Napsin-A polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human Napsin-A polyclonal Antibody, Biotin conjugated
MBS1488357-03 5x 0.1 mg

Rabbit anti-human Napsin-A polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
ZymoBIOMICS 96 DNA Kit (2 x 96 preps.pp) Includes: [D4307] ZymoBIOMICS 96 DNA Kit x 1, [S6012-50] ZR BashingBead Lysis Tubes (0.1mm & 0.5 mm) 50 pack x 4 [D4300-1-150] ZymoBIOMICS Lysis Solution, 150 mL x 1
D4309 2x 96 Preparations

ZymoBIOMICS 96 DNA Kit (2 x 96 preps.pp) Includes: [D4307] ZymoBIOMICS 96 DNA Kit x 1, [S6012-50] ZR BashingBead Lysis Tubes (0.1mm & 0.5 mm) 50 pack x 4 [D4300-1-150] ZymoBIOMICS Lysis Solution, 150 mL x 1

Sign In for Pricing
View Details